MSAD_221065.t1 (mRNA; Medicago sativa )

Overview
Namespada-crp6120_Scc4a34_509_5M_1
Unique NameMSAD_221065.t1
TypemRNA
OrganismMedicago sativa (alfalfa)
Sequence length135
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
spada-h5877.02MSAD_221065Medicago sativagene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
spada-crp6120_Scc4a34_509_5M_1MSAD_221065.t1-proteinMedicago sativapolypeptide


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
MSAD_221065.t1-CDS-Scc4a34_509-1492110926:5012091..5012225MSAD_221065.t1-CDS-Scc4a34_509-1492110926:5012091..5012225Medicago sativaCDS


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
MSAD_221065.t1-exon-Scc4a34_509-1492110926:5012091..5012225MSAD_221065.t1-exon-Scc4a34_509-1492110926:5012091..5012225Medicago sativaexon


Sequences
The following sequences are available for this feature:

mRNA sequence

>MSAD_221065.t1 ID=MSAD_221065.t1|Name=spada-crp6120_Scc4a34_509_5M_1|organism=Medicago sativa|type=mRNA|length=135bp
ATGAAGCCTACATTAGTTACCACCCTTTGTTTCCTCCTCTTTTCCTTCAT
CACCTACTTTCCATTACCCTTTACACAAGCTGATCTTATCGTCAAGGATA
TATATGGGAACCCCGTTGTTCCTAGTAAGTGGTAG
back to top

protein sequence of spada-crp6120_Scc4a34_509_5M_1

>MSAD_221065.t1-protein ID=MSAD_221065.t1-protein|Name=spada-crp6120_Scc4a34_509_5M_1|organism=Medicago sativa|type=polypeptide|length=45bp
MKPTLVTTLCFLLFSFITYFPLPFTQADLIVKDIYGNPVVPSKW.
back to top

mRNA from alignment at Scc4a34_509:5012091..5012225-

Legend: CDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>MSAD_221065.t1 ID=MSAD_221065.t1|Name=spada-crp6120_Scc4a34_509_5M_1|organism=Medicago sativa|type=mRNA|length=135bp|location=Sequence derived from alignment at Scc4a34_509:5012091..5012225- (Medicago sativa)
ATGAAGCCTACATTAGTTACCACCCTTTGTTTCCTCCTCTTTTCCTTCAT CACCTACTTTCCATTACCCTTTACACAAGCTGATCTTATCGTCAAGGATA TATATGGGAACCCCGTTGTTCCTAGTAAGTGGTAG
back to top

Coding sequence (CDS) from alignment at Scc4a34_509:5012091..5012225-

>MSAD_221065.t1 ID=MSAD_221065.t1|Name=spada-crp6120_Scc4a34_509_5M_1|organism=Medicago sativa|type=CDS|length=135bp|location=Sequence derived from alignment at Scc4a34_509:5012091..5012225- (Medicago sativa)
ATGAAGCCTACATTAGTTACCACCCTTTGTTTCCTCCTCTTTTCCTTCAT
CACCTACTTTCCATTACCCTTTACACAAGCTGATCTTATCGTCAAGGATA
TATATGGGAACCCCGTTGTTCCTAGTAAGTGGTAG
back to top
Properties
Property NameValue
NoteKunitz type trypsin inhibitor / Alpha-fucosidase SPADA:33.7:0:Medtr6g045403
CADL Non-redundant FlagY
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Gene Ontology Update2017-11-12
Whole Genome Assembly and Annotation of Medicago sativa2016-01-05
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Scc4a34_509supercontigScc4a34_509:5012091..5012225 -
Gene Ontology
GO Assignments
This mRNA is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0004866 endopeptidase inhibitor activity