MSAD_210097.t1 (mRNA; Medicago sativa )

Overview
NameMSAD_210097.t1
Unique NameMSAD_210097.t1
TypemRNA
OrganismMedicago sativa (alfalfa)
Sequence length853
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
MSAD_210097MSAD_210097Medicago sativagene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210097.t1MSAD_210097.t1-proteinMedicago sativapolypeptide


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210097.t1:exon:127MSAD_210097.t1:exon:127Medicago sativaexon
MSAD_210097.t1:exon:128MSAD_210097.t1:exon:128Medicago sativaexon


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210097.t1:cdsMSAD_210097.t1:cdsMedicago sativaCDS


Synonyms
The feature 'MSAD_210097.t1' has the following synonyms
Synonym
maker-Scc4a34_26-augustus-gene-3.34-mRNA-1
Sequences
The following sequences are available for this feature:

mRNA sequence

>MSAD_210097.t1 ID=MSAD_210097.t1|Name=MSAD_210097.t1|organism=Medicago sativa|type=mRNA|length=853bp
AATTGTTCTATCATTTCCACATTTCAGTTCATATCTCTCTCTTTCTCTCT
CCCCTCACAAACCTAGCTAGAAAGAGAAGAAAATTCTAACCAACATGGTA
CAATCAAAGAAGTTCAGAGGTGTCAGGCAACGCCATTGGGGCTCTTGGGT
CTCTGAGATTCGTCATCCATTATTGAAAAGGAGGGTGTGGCTAGGAACAT
TTGAAACAGCTGAAGAAGCAGCTAAAGCATATGATGAAGCAGCAATTTTG
ATGAGTGGAAGAAATGCAAAAACTAACTTTCCAATTAATGTGGAAAATCA
AACCAATTCTATTTCAACTTCTTCCAAAGCATTTTCTGCAGTTCTTAGTG
CAAAGTTAAGGAAGTGCTGCAAGTTTCCTTCACCTTCACTCACTTGCTTG
AGGCTTGATGCAGAGAATTCACACATTGGAGTATGGCAGAAAGGTGCAGG
TCCTCGTTCTGAATCCAATTGGCTTATGATGGTTGAGTTAGAAAGGAAAA
AAAGTGATTCTGTTCCAGAGAAGGTAAAGCCAGAGGAATTAAGTAAAAAT
GGTTTGGATGATGAACAGAAAATTGCTTTGCAGATGATAGAAGAACTTCT
CAATAGAAACTAAACTAAACTAAACTAAACTCTATGCTTTCACTTTCATG
TGTGGACCTCATTGAAGGAGTTTAATTTGATGTCCATGATGATGTCTTTT
GTTTGTTTGTTTTGTCCTAAGTAAGAGTGTGATATATGATGATATATTGT
GTTTTACTTTACCACATGTGTAACGGTCTCTACCATATATCTAAAATTTT
ATGTCTATAAGAAAAACTATCCAGTTAGTTAACTAACTTGGAATTACTCT
ATA
back to top

protein sequence of MSAD_210097.t1

>MSAD_210097.t1-protein ID=MSAD_210097.t1-protein|Name=MSAD_210097.t1|organism=Medicago sativa|type=polypeptide|length=173bp
MVQSKKFRGVRQRHWGSWVSEIRHPLLKRRVWLGTFETAEEAAKAYDEAA
ILMSGRNAKTNFPINVENQTNSISTSSKAFSAVLSAKLRKCCKFPSPSLT
CLRLDAENSHIGVWQKGAGPRSESNWLMMVELERKKSDSVPEKVKPEELS
KNGLDDEQKIALQMIEELLNRN.
back to top

mRNA from alignment at Scc4a34_26:325905..327182+

Legend: exonCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>MSAD_210097.t1 ID=MSAD_210097.t1|Name=MSAD_210097.t1|organism=Medicago sativa|type=mRNA|length=1278bp|location=Sequence derived from alignment at Scc4a34_26:325905..327182+ (Medicago sativa)
AATTGTTCTATCATTTCCACATTTCAGTTCATATCTCTCTCTTTCTCTCT CCCCTCACAAACCTAGCTAGAAAGAGAAGAAAATTCTAACCAACATGGTA CAATCAAAGAAGTTCAGAGGTGTCAGGCAACGCCATTGGGGCTCTTGGGT CTCTGAGATTCGTCATCCATTATTGTATTAACCTTTCACTTTCATTTATT TTATTTATATTGTTTTCCTTCTCCTCAAACTTTAGAAAAAATATTATATT ATAGTGTATGTTTGGATACACGGCGGATTTGATAAAATCAGACGTGATAT TGTGATTCTGCTAAATTTATCGTCAATCAAAACATGCACACTTTTTCGGT TTATAGAATATATTATAGTGTATGTTTGGATACACGACGGATTTGATAAA ACCAGACGTACGTTATACTATAATTTTATTGAAGCTAGTGTAGTTTTTGC AAAACCATATGACACATCATAATTTTGCTAAATTCATCGTCAATCCGAAC ATGTACGCCTTTTCAGTCTATAATTTGGTTATGTATGTAAATTTCATTTA TATTTTTGTGTTAGTTGAGTTATTATATTTTATATGGTGGTATGAATAGG AAAAGGAGGGTGTGGCTAGGAACATTTGAAACAGCTGAAGAAGCAGCTAA AGCATATGATGAAGCAGCAATTTTGATGAGTGGAAGAAATGCAAAAACTA ACTTTCCAATTAATGTGGAAAATCAAACCAATTCTATTTCAACTTCTTCC AAAGCATTTTCTGCAGTTCTTAGTGCAAAGTTAAGGAAGTGCTGCAAGTT TCCTTCACCTTCACTCACTTGCTTGAGGCTTGATGCAGAGAATTCACACA TTGGAGTATGGCAGAAAGGTGCAGGTCCTCGTTCTGAATCCAATTGGCTT ATGATGGTTGAGTTAGAAAGGAAAAAAAGTGATTCTGTTCCAGAGAAGGT AAAGCCAGAGGAATTAAGTAAAAATGGTTTGGATGATGAACAGAAAATTG CTTTGCAGATGATAGAAGAACTTCTCAATAGAAACTAAACTAAACTAAAC TAAACTCTATGCTTTCACTTTCATGTGTGGACCTCATTGAAGGAGTTTAA TTTGATGTCCATGATGATGTCTTTTGTTTGTTTGTTTTGTCCTAAGTAAG AGTGTGATATATGATGATATATTGTGTTTTACTTTACCACATGTGTAACG GTCTCTACCATATATCTAAAATTTTATGTCTATAAGAAAAACTATCCAGT TAGTTAACTAACTTGGAATTACTCTATA
back to top

Coding sequence (CDS) from alignment at Scc4a34_26:325905..327182+

>MSAD_210097.t1 ID=MSAD_210097.t1|Name=MSAD_210097.t1|organism=Medicago sativa|type=CDS|length=519bp|location=Sequence derived from alignment at Scc4a34_26:325905..327182+ (Medicago sativa)
ATGGTACAATCAAAGAAGTTCAGAGGTGTCAGGCAACGCCATTGGGGCTC
TTGGGTCTCTGAGATTCGTCATCCATTATTGAAAAGGAGGGTGTGGCTAG
GAACATTTGAAACAGCTGAAGAAGCAGCTAAAGCATATGATGAAGCAGCA
ATTTTGATGAGTGGAAGAAATGCAAAAACTAACTTTCCAATTAATGTGGA
AAATCAAACCAATTCTATTTCAACTTCTTCCAAAGCATTTTCTGCAGTTC
TTAGTGCAAAGTTAAGGAAGTGCTGCAAGTTTCCTTCACCTTCACTCACT
TGCTTGAGGCTTGATGCAGAGAATTCACACATTGGAGTATGGCAGAAAGG
TGCAGGTCCTCGTTCTGAATCCAATTGGCTTATGATGGTTGAGTTAGAAA
GGAAAAAAAGTGATTCTGTTCCAGAGAAGGTAAAGCCAGAGGAATTAAGT
AAAAATGGTTTGGATGATGAACAGAAAATTGCTTTGCAGATGATAGAAGA
ACTTCTCAATAGAAACTAA
back to top
Properties
Property NameValue
NoteEthylene response factor MAKER:9.1:0.14:Medtr2g103700
AED0.14
QI94|1|1|1|1|1|2|240|172
eAED0.14
CADL Non-redundant FlagY
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Gene Ontology Update2017-11-12
Whole Genome Assembly and Annotation of Medicago sativa2016-01-05
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Scc4a34_26supercontigScc4a34_26:325905..327182 +
Gene Ontology
GO Assignments
This mRNA is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006351 transcription, DNA-templated
cellular_component GO:0005634 nucleus
molecular_function GO:0003677 DNA binding
molecular_function GO:0003700 transcription factor activity, sequence-specific DNA binding