MSAD_210094.t1 (mRNA; Medicago sativa )

Overview
NameMSAD_210094.t1
Unique NameMSAD_210094.t1
TypemRNA
OrganismMedicago sativa (alfalfa)
Sequence length3932
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
MSAD_210094MSAD_210094Medicago sativagene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210094.t1MSAD_210094.t1-proteinMedicago sativapolypeptide


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210094.t1:cdsMSAD_210094.t1:cdsMedicago sativaCDS


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210094.t1:exon:142MSAD_210094.t1:exon:142Medicago sativaexon
MSAD_210094.t1:exon:143MSAD_210094.t1:exon:143Medicago sativaexon
MSAD_210094.t1:exon:144MSAD_210094.t1:exon:144Medicago sativaexon
MSAD_210094.t1:exon:145MSAD_210094.t1:exon:145Medicago sativaexon
MSAD_210094.t1:exon:146MSAD_210094.t1:exon:146Medicago sativaexon
MSAD_210094.t1:exon:147MSAD_210094.t1:exon:147Medicago sativaexon
MSAD_210094.t1:exon:148MSAD_210094.t1:exon:148Medicago sativaexon
MSAD_210094.t1:exon:149MSAD_210094.t1:exon:149Medicago sativaexon
MSAD_210094.t1:exon:150MSAD_210094.t1:exon:150Medicago sativaexon
MSAD_210094.t1:exon:151MSAD_210094.t1:exon:151Medicago sativaexon


Synonyms
The feature 'MSAD_210094.t1' has the following synonyms
Synonym
maker-Scc4a34_26-snap-gene-3.54-mRNA-1
Sequences
The following sequences are available for this feature:

mRNA sequence

>MSAD_210094.t1 ID=MSAD_210094.t1|Name=MSAD_210094.t1|organism=Medicago sativa|type=mRNA|length=3932bp
TTGAATAAATAAACTCCTACTATATCTCGGTTCTATTCCTTTTCCCATTC
ATCATTCACCAACTACTCTCATTTTCATCTCTGAACTGAACTCTACACAA
GTAATTGATGGCGCAAATTCTGCTACATGGAACTCTTCATGCTACAATCT
TTGAGGTCGATAAACTCAAGAATATTAGTGGTGGTAACATTCTTTCCAAG
ATAAGACAAAACTTTGAGGAGACAGTTGGATTCGGAAAAGGAACTACCAA
ACTTTATGCAACCATTGATTTAGAGAAAGCACGAGTGGGAAGGACCAGAA
TCATAGAAAAGGAGCATGTTAATCCTCAATGGAATGAGTCTTTTCACATT
TACTGTGCCCATTTGGCATCGGATATCATATTCACTGTGAAAGATGATAA
TCCTATTGGGGCAACCTTAATTGGAAGGGCGTACATTCCTGTTGAGGAGG
TATTGGGTGGTGAGGAAATAGATAGGTGGGTTGAAATATTGGATGTGAAT
AAAGAACCAATTCATGGAAATTCAAAGATCCATGTGAAGCTGCAATTTTT
TGATGTTTCAAAAGACCGCAACTGGGCTCTAGGCATTAGAAGTCCTAAAT
TTCCTGGAGTTCCTTATGCTTTCTACACACAAAGACAAGGTTGTAAGGTT
TCTCTGTACCAAGATTCTCATATCCCAGACAATTTTGTCCCCAATATACA
ACTTGCAGGAGGTCAGACTTACCAGCCTCATAGATGTTGGGAGGATGTTT
TTGATGCAATCACAAAAGCAAGGCACTTAATATACATTACAGGGTGGTCT
GTTTATACTGAGATTTCCTTGGTAAGGGATTCAAGGAGGCCAAAGCCAGG
AGGAGACATCACACTTGGTGAGCTTCTCAAGAAAAAAGCACAAGAAGGTG
TTAGGGTATTAATGCTTGTTTGGGATGATAGAACGTCGGTTCCTCTGTTA
AAAAAAGATGGGTTGATGGCTACTCATGATCAAGAAACTGAGGAATTCTT
CCGAGGCTCTGAAGTGCACTGTGTCTTATGCCCTCGCAATCCGGATGATG
GTGGAAGCATTGTCCAGAATATAGAAATTGGCACCATGTTTACTCATCAT
CAGAAAATTTTGGTGGTGGACAGTGAGTTGCCAAATGAAGTGGGATTAAA
TAAACGAAGAATTGTGAGTTTTGTAGGAGGCATTGATCTCTGTGATGGAA
GATATGATACCCCGTTTCATTCACTTTTCCGAACTCTGGACACAGCACAT
CATGATGACTTTCATCAGCCTAACTTTCCTGGTGCTTCAATAGAAAAAGG
TGGTCCTAGGGAACCTTGGCATGATATCCACTCAAGGCTTGAAGGTCCCA
TTGCTTGGGATGTTTTGTTTAACTTTGAGCAGAGATGGAGGAAGCAAGGT
GGAAAGGACTTGCTTGTTCCTCTGAGAGAGCTTGAAGATGCCATTATTAC
CCCATCCCCAGTAACTTTCCCTGATGATCAAGAGACATGGAATGTTCAGC
TATTTAGATCTATTGACGGTGGAGCAGCTTTCGGGTTCCCCGAGACTCCT
GAAGATGCTGCTAAAGCTGGGCTTATTAGTGGGAAGGATAACATAATAGA
TAGGAGTATTCAAGATGCTTATATCAATGCTATTCGACGCGCAAAGAATT
TCATCTACATTGAAAATCAATATTTCCTTGGAAGTTGCTATGCGTGGAGT
GCTGATGGTATTAAGCCTGAAGACATTGGTGCTTTGCATCTGATCCCAAA
AGAGCTTTCACTTAAGATTGTTAGCAAGATTGAAGCTGGGGAAAGGTTCA
CTGTGTATGTTGTGGTTCCCATGTGGCCTGAGGGTGTCCCAGAAAGTGCA
TCAGTTCAGGCAATATTAGACTGGCAGAGGAGGACAATGGATATGATGTA
CAAAGATATTATTGAAGCACTCAATGCCAAGGGAATTGAGGAAGATCCTC
GGAACTATTTGACGTTCTTCTGCCTTGGCAATCGTGAGGTGGTAAAACAA
GGAGAGTACGAGCCTCCTGAAAGACCAGAACCTGATTCAGATTATATGCG
AGCTCAAGAGGCCAGGCGTTTCATGATTTATGTTCATGCCAAGATGATGA
TAGTTGATGATGAATACATAATCGTCGGATCTGCCAACATCAACCAAAGA
TCAATGGATGGTGCTAGAGACTCTGAAATTGCAATGGGAGCTTATCAACC
CTATCATTTAGCTAATAGGCAGCCTGCAAGGGGTCAGATTCATGGTTTCC
GCATGTCGTTGTGGTATGAGCACCTTGGCATGCTTCAAGAAACCTTCCTT
CACCCAGAAAGTGAAGAATGCATTAGGAAGGTGAACCAGATTGCTGACAA
ATATTGGGATCTCTATTCTAGCGAGACTCTTGAGCATGATCTCCCTGGCC
ACCTTCTCCGCTATCCCATTGGGGTTTCCAGTGAAGGAAGCGTGACAGAG
CTGCCAGGATTTGAATTCTTCCCTGACACCAAGGCTCGTGTTCTTGGCGG
AAAAAGAAAGCTGTATAATCATCGGCGTGGCCGAAATTGGAGGCGAGTTT
TGAGGTTTTTGCAACCTGTTGAACAATCCTCTGATATGGTTGAGATACAA
TTAGGAAATGATATAATCACACCTTGGCAATCAGCAACTCCTCCGTCTAT
TCTTGCGGTTCTTCTTTGTTTGGCGTACTTGGCCAAGGGTCTGAAAAAAC
AGTGTTCAGCATTTACCCGAATCAATTTCCCACCTTTGGCGCGTGTGGCA
CATGTTTCGGCCTCAAATAGTGATGCAGTTTTTGTTATGCAGTCTGGAGA
GGTATTTACATGTGGGAGTAATTCATATTCGTGCTGTGGACATGGAGATA
CAAGTCAAATAATTTTCAGGCCGCGTCTTGTTGAATCCTTAAAGGGGATT
CCTTGCAAGCAGACAAGGTCATGTGTATACATGAGGAATAAACTCACGCG
GCCAACTTGGTCACGGCGACACTCAGAACATAACAATCCCTAAAATGATT
CAATTCCTCTGTGATGTGGGTCCTGTTGTTCAGGTTGCTGCTGGATCAGA
CTATATCTTATCAGTAACAGAAGATGGATCAGTATACTCCTTTGGATCAG
GTTATCATTTTTGTCTCGGCCATGGTGAGGATGACAACGAGCTTCTACCA
CGTTTGATACAAAAATTTAGAAGAAATCGTATTTGTGTTGTCTGCGTATC
TGCTGGGGATGAGCGAGCATGCAACTGCACTTGATTCAAATGGATTTGTA
TATACATGGGGCAAGGGATATTGTGGTGCTTTAGGCCATGGAGATGAGAT
TGAAAGGACAAGACCAGAGATGTTGTCTAGTCTCAAGAATCACTTGGCTA
TTCAGGTGTGTGCAAACCATAGAAAAACCTTTGCTCTACTTGATTCAGGT
TTGGTCTATGGCTTTGGCTCCATTGCATTTGGCAGCCTAGGAATTTTGGG
CAAAAGGGTATCTGATATAATATTAAAGCCTAGAATATTAAGTACATTAA
GATCTCACCATGTTTCTCAAATTAGCACTGGTCCTTGTCACGCTGTGGTA
GTCACCAACCGTGGACAAATATTTGGCTTTGGAGACAATGAAAGAGCTCA
ACTTGGTAAGAGAATGCCATGAGCCTACTGAAATTTTCATAGAAAATTAA
TCTGAAGATGATCCTATGTTAGAAAGCAGCATCTGACACATCAAGATAAG
TCACATTTTTTTATGTTTGGTTCACCTGAATTTTTAAGTAAGATTATGTT
ATACTTGTAAAAGTTTAGTGTTTTATATCTTATTACATCCTTCGCACCCA
AAATTATTGAAGAGGTGGAATCTATGTTTTTTCTTTTTTGGTGGCTACTT
TCAGATGTTGTCCAAATTACATGGGTTATTTGAGGTATTAAATTCTATTA
TAAAAAAATGATTGACAATAAATTGAAGGCGC
back to top

protein sequence of MSAD_210094.t1

>MSAD_210094.t1-protein ID=MSAD_210094.t1-protein|Name=MSAD_210094.t1|organism=Medicago sativa|type=polypeptide|length=962bp
MAQILLHGTLHATIFEVDKLKNISGGNILSKIRQNFEETVGFGKGTTKLY
ATIDLEKARVGRTRIIEKEHVNPQWNESFHIYCAHLASDIIFTVKDDNPI
GATLIGRAYIPVEEVLGGEEIDRWVEILDVNKEPIHGNSKIHVKLQFFDV
SKDRNWALGIRSPKFPGVPYAFYTQRQGCKVSLYQDSHIPDNFVPNIQLA
GGQTYQPHRCWEDVFDAITKARHLIYITGWSVYTEISLVRDSRRPKPGGD
ITLGELLKKKAQEGVRVLMLVWDDRTSVPLLKKDGLMATHDQETEEFFRG
SEVHCVLCPRNPDDGGSIVQNIEIGTMFTHHQKILVVDSELPNEVGLNKR
RIVSFVGGIDLCDGRYDTPFHSLFRTLDTAHHDDFHQPNFPGASIEKGGP
REPWHDIHSRLEGPIAWDVLFNFEQRWRKQGGKDLLVPLRELEDAIITPS
PVTFPDDQETWNVQLFRSIDGGAAFGFPETPEDAAKAGLISGKDNIIDRS
IQDAYINAIRRAKNFIYIENQYFLGSCYAWSADGIKPEDIGALHLIPKEL
SLKIVSKIEAGERFTVYVVVPMWPEGVPESASVQAILDWQRRTMDMMYKD
IIEALNAKGIEEDPRNYLTFFCLGNREVVKQGEYEPPERPEPDSDYMRAQ
EARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPYH
LANRQPARGQIHGFRMSLWYEHLGMLQETFLHPESEECIRKVNQIADKYW
DLYSSETLEHDLPGHLLRYPIGVSSEGSVTELPGFEFFPDTKARVLGGKR
KLYNHRRGRNWRRVLRFLQPVEQSSDMVEIQLGNDIITPWQSATPPSILA
VLLCLAYLAKGLKKQCSAFTRINFPPLARVAHVSASNSDAVFVMQSGEVF
TCGSNSYSCCGHGDTSQIIFRPRLVESLKGIPCKQTRSCVYMRNKLTRPT
WSRRHSEHNNP.
back to top

mRNA from alignment at Scc4a34_26:300240..310763-

Legend: exonCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>MSAD_210094.t1 ID=MSAD_210094.t1|Name=MSAD_210094.t1|organism=Medicago sativa|type=mRNA|length=10524bp|location=Sequence derived from alignment at Scc4a34_26:300240..310763- (Medicago sativa)
TTGAATAAATAAACTCCTACTATATCTCGGTTCTATTCCTTTTCCCATTC ATCATTCACCAACTACTCTCATTTTCATCTCTGAACTGAACTCTACACAA GTTAGTCTCTCTCCTCTTCATCTTCTTCGATTTTGTTTTCACATATTTGT TAGATCCATTTTAAATTCTAATCATTTGTATAAACTAACTATAGTTAAAC TTTGTAGGTAATTGATGGCGCAAATTCTGCTACATGGAACTCTTCATGCT ACAATCTTTGAGGTCGATAAACTCAAGAATATTAGTGGTGGTAACATTCT TTCCAAGGTGCTTCTTTTCTTCCTTTTTTTTTTTGGCTTTTATTATCATT TTTTCAACTACTTGCTAACTGTTTTTTTACTTAACTTAGTTCTTATGTTT CTGTTATTTGTTTGTTGTACGGTTAGATCTATGAAGCACTGACACAGACA CCGGACGGATGGACAGTCAGCACTGATAATATAAATTAATTGAATGTAAT CACTAGTGTCTGTCGTGCACACACGCATTCAATCAGAAGTATCGGTGCTA CTGAGATTAGATCATATAATTTAACAAAATTAGTGCAGTAGTTTGTTGTT AATCTCATCAATTTGTGATTCAGATTTCATGATCAATAATTCAATCTGAA ATTTTGTTAGGTTAATTGTAATTTTTGGTAGAGTTTTGCCACTGTTTTGG CTTCATCTCTAATCTTCAAATCTGTGATCAGCTTGATGAGATTTGTTCTT TAAACATGGAGATTGAATTTTCTTTGATCTTTGACTTGTAGCTTGTTGAC TTTTCACGCCTTATCAGAAAGACTTGAACTGATAAACTCATAAATGTTTG AATGGTAGTGAAGGACTAGTTAGTTGGAAGGATAAAGGATTAATTTTTTT TTCTTTCTAAGTCCGAAGATTTGATTTTTATTTTTTGTGAAAAAGAAAAA GGGAAAAAATTAGATTGTAAGAATGAAAAAAGGGAAAGTGTAAAGAGATG GTGGTTGGGATTGGTCCATGGATAAGACAGAAGTTCATCAAGGCAAGAAT ATGTTTCTTACCAATCACATTTAATGTTCTTTTGTACTCAGAATCTTGAT TGTTTTTGCTCTCTGTGTTGGTGAAATAATTGTTAGAAGAAAATAATAAG CTAAAAAAAGTAAATCACTTTAGGCCTTTAGAAGTTTTTGGGCAAATGAT TCATCACCTTGGATTTTTATAATATCGCCAATTGTATGGCTAGGCTTCTA ATAACAATATTTTAACGTCATTATTACTGTTGTAAATTTCTAACTGGATT GTAGAGTTTGCTAGCTATTATGTTTCAGACAGTTTATATATTCATTTAGA TTATTAGGGATCACATAATGTTTTGCTACTTCAAATGTTTAATGTTTGAT TTTAATTGTGAAGGGAAAGTTTTTCAAAAAAAATTGTGAAGGGAAAGTTT TTACAATGTTCTGCTTCCTTAATTTGTTCATTTGAATCTATTTGTCACCT GTCGGCCTGAAATTAAAATGACCTTTTGTTCATTAAGCTGGTCTTTCAAC TCAATAACTTCAAATTTTATCATACTTATCCTTTATCCTGCATATGCTAT GTTTTATCCCAAAAAACATGAACACATATGAACTCAAAGGAAACAAACCT GGATCTTTGTTAGGTTTGTGTTAGTAGCTTGACTTCATCCTTATCGAAGC CTCTGATGGGATATTTTTAAGAATGGGTTCGAATGCTTTACCTTAACAAT CTATTCTTTTGATCTTAACCTTGTTCGTTTTAGGGTAGACTTTTGCTTGG AGCTCCCTTCGTTTTAGCATAAGTGCATGCATATTTTTACTGAAGATCAT CCACTTATGTTTACATGCGTTAGTGCCCTGATGAAAATATTTTTGTTTCA CTTTTGTACCTTTATTACATGATGGAAGGATAATTTTTCACTTTTGGACC TTTATTTCCCATGTACGTCGTTGTTGATTGTTGATTTATGTGTTGCTAAT TACATTCACTTATTCTTTTTTTAGATAAGACAAAACTTTGAGGAGACAGT TGGATTCGGAAAAGGAACTACCAAACTTTATGCAACCATTGATTTAGAGA AAGCACGAGTGGGAAGGACCAGAATCATAGAAAAGGAGCATGTTAATCCT CAATGGAATGAGTCTTTTCACATTTACTGTGCCCATTTGGCATCGGATAT CATATTCACTGTGAAAGATGATAATCCTATTGGGGCAACCTTAATTGGAA GGGCGTACATTCCTGTTGAGGAGGTATTGGGTGGTGAGGAAATAGATAGG TGGGTTGAAATATTGGATGTGAATAAAGAACCAATTCATGGAAATTCAAA GATCCATGTGAAGCTGCAATTTTTTGATGTTTCAAAAGACCGCAACTGGG CTCTAGGCATTAGAAGTCCTAAATTTCCTGGAGTTCCTTATGCTTTCTAC ACACAAAGACAAGGTTGTAAGGTTTCTCTGTACCAAGATTCTCATATCCC AGACAATTTTGTCCCCAATATACAACTTGCAGGAGGTCAGACTTACCAGC CTCATAGATGTTGGGAGGATGTTTTTGATGCAATCACAAAAGCAAGGCAC TTAATATACATTACAGGGTGGTCTGTTTATACTGAGATTTCCTTGGTAAG GGATTCAAGGAGGCCAAAGCCAGGAGGAGACATCACACTTGGTGAGCTTC TCAAGAAAAAAGCACAAGAAGGTGTTAGGGTATTAATGCTTGTTTGGGAT GATAGAACGTCGGTTCCTCTGTTAAAAAAAGATGGGTTGATGGCTACTCA TGATCAAGAAACTGAGGAATTCTTCCGAGGCTCTGAAGTGCACTGTGTCT TATGCCCTCGCAATCCGGATGATGGTGGAAGCATTGTCCAGAATATAGAA ATTGGCACCATGTTTACTCATCATCAGAAAATTTTGGTGGTGGACAGTGA GTTGCCAAATGAAGTGGGATTAAATAAACGAAGAATTGTGAGTTTTGTAG GAGGCATTGATCTCTGTGATGGAAGATATGATACCCCGTTTCATTCACTT TTCCGAACTCTGGACACAGCACATCATGATGACTTTCATCAGCCTAACTT TCCTGGTGCTTCAATAGAAAAAGGTGGTCCTAGGGAACCTTGGCATGATA TCCACTCAAGGCTTGAAGGTCCCATTGCTTGGGATGTTTTGTTTAACTTT GAGCAGAGATGGAGGAAGCAAGGTGGAAAGGACTTGCTTGTTCCTCTGAG AGAGCTTGAAGATGCCATTATTACCCCATCCCCAGTAACTTTCCCTGATG ATCAAGAGACATGGAATGTTCAGCTATTTAGATCTATTGACGGTGGAGCA GCTTTCGGGTTCCCCGAGACTCCTGAAGATGCTGCTAAAGCTGGGCTTAT TAGTGGGAAGGATAACATAATAGATAGGAGTATTCAAGATGCTTATATCA ATGCTATTCGACGCGCAAAGAATTTCATCTACATTGAAAATCAATATTTC CTTGGAAGTTGCTATGCGTGGAGTGCTGATGGTATTAAGCCTGAAGACAT TGGTGCTTTGCATCTGATCCCAAAAGAGCTTTCACTTAAGATTGTTAGCA AGATTGAAGCTGGGGAAAGGTTCACTGTGTATGTTGTGGTTCCCATGTGG CCTGAGGGTGTCCCAGAAAGTGCATCAGTTCAGGCAATATTAGACTGGCA GAGGAGGACAATGGATATGATGTACAAAGATATTATTGAAGCACTCAATG CCAAGGGAATTGAGGAAGATCCTCGGAACTATTTGACGTTCTTCTGCCTT GGCAATCGTGAGGTGGTAAAACAAGGAGAGTACGAGCCTCCTGAAAGACC AGAACCTGATTCAGATTATATGCGAGCTCAAGAGGCCAGGCGTTTCATGA TTTATGTTCATGCCAAGATGATGATAGGTAAGTAAAAACATTAAGCTGCC ATATTTTGTATAACATTCCTTCTAACACTTTCTTTCCAATACTTTTTTTA TGATTGAGCAATGTTCACATGGGTCTCCTTTCCTATTTAGTAGGTCTCCT TTTCAAAATGATTGAGACCCACATGAATTTTACTCAAACCTCACTCGCTC ATCATATAGTAGTCAAGAGCAATTCTGCAAGCTACACAATTCTCACGCAG AATTTTGATTTTAAAGTTATTTGTAGGATAAAAGGAAAAAAATTACTTTA TTCTAATTATTCATTTAGATAAGTTGGTCCACATTTGGACAAAAAAATTC TTGAGAAGCTTTTTTACTCTTTCAACAAATTTGAGATTAATAAAAGAAAG CTGGTAAGTGTTACAATATCCCTTTTCCTTCACCAAGAAAATATCCTTTG ATGGTAGGAGTTCATAGTGTGGTAAAACTAAGTTTGTTGTTTGCAGTTGA TGATGAATACATAATCGTCGGATCTGCCAACATCAACCAAAGATCAATGG ATGGTGCTAGAGACTCTGAAATTGCAATGGGAGCTTATCAACCCTATCAT TTAGCTAATAGGCAGCCTGCAAGGGGTCAGATTCATGGTTTCCGCATGTC GTTGTGGTATGAGCACCTTGGCATGCTTCAAGAAACCTTCCTTCACCCAG AAAGTGAAGAATGCATTAGGAAGGTGAACCAGATTGCTGACAAATATTGG GATCTCTATTCTAGCGAGACTCTTGAGCATGATCTCCCTGGCCACCTTCT CCGCTATCCCATTGGGGTTTCCAGTGAAGGAAGCGTGACAGAGCTGCCAG GATTTGAATTCTTCCCTGACACCAAGGCTCGTGTTCTTGGCGGAAAAGTT GATTACCTCCCACCCATACTTACTACTTAGTTTCGTTTTCTACTTTGTTC ACCAAATATAGTATTTGTGGTGTTAGTGTGAGCAATGACTGTAATGGTAC AATGGTCCTGCGAAACTGTTTTTTCTTTTAAAAACTGCTAATAAGCTTGA GATGATTAAGGACTTTGCTGTTGATTTGTAATGCTTGTTTCTGCTCTTTC TATGTATAACTATGATAAATTCTAGCTAGGAATCCTTGACATGTATTCTA CTATATCATATTTGTTGTAATTTTAAAATTGTAGTATTTTTTTTTTCTCA TTTCATGAATATTAAATAATTTTCCTTCTCAAAGGCTAAAAAACTCATGA ACTTTCCATAAAACTATAACCACAAGGAAGTTTGCACAGTTTAGACGATC ATATCATAGATTTAAATCAACAATCCATTTTGATATCCAAAACATAAAAT ATTTTTGGTACAATGATAAGGCAAACATAGGAATAATGTTAGGGAAATGT TAACGAGTTCCCCAGGGCACTCTTTAAGCACTTTAATTAGTAAGTATTTT ATGAAAAGCTGTGTGGTTCTCATGCCATCGATTCCATGATGAGTTTAGAG TTCTCAGAGAAAGCTGTATAATCATCGGCGTGGCCGAAATTGGAGGCGAG TTTTGAGGTTTTTGCAACCTGTTGAACAATCCTCTGATATGGTTGAGATA CAATTAGGAAATGTACTATTCATTTCATTATATAAACCATTTTTGTTTGT TTGTTTCCTTTTGAGTTATGTATGAGTTACAGTTTTTTCAGTTTTTATTT TATAACGAGTACCTTTTTTAACATTGGTGATTGATCCCTCAAGACCTGAG ATCAACAGCCTCGTTGTGATTGTGGTAGCTTTGTGGTCGCTGGACTCTTT TTAACATCGGTGATTGATCCGTCAAGACCTGAGATCAACAACCTCGTTGT GATTGTGGTAGCTTTGTGGTCGCCGGACTCCAAATGGTAGCTTCCTTCTC TCCGGAGGGGGTGGTGTACCTGCAAACACTCTAACGATTAAGTAAGAATG CACTGAATATGTGAGGTTTTAGGGTAAAAAAGTGTGTACCAGGAAGGAAG CTATGAGTTAGCCTTTATAGTGGTGAATTAGGGTTTTTGGTCGTCCTTCC AAGCCTAACTCAGACAGCTATCCCGAAGGGACACCTGTGAGCAGATTTTG AGGAAACTAACCTTGGATCCCGAATGAATGGTCCAGATTGGCTTATGCGA CTGTGATAAAGGCTTTATGTTTTTCATGACTTTGCTTTTCAACCCCAAGT TGTTCAAACAGAACAGTTTATATGGTATGGCCTATCGCAATTTCTTTTTA TAAAGGCTTGTCACCATTGTACATTTGTAATAAGAGATATAATAACACAT TTCTGTAATAATTAGAACAGAAACAAAAAAGGAAATGAATTTGGAGTTTT ATATGTTGTCTATAATGATAATGATAACAAGTTTAAGAACAAATTTTAAT TTCGATGATCTTTTAACGTAATTTTGTACTTGTGTGTCTTTAGTATTCTA AATGTCCTTTTATAACAAGCGTTGTGGAGTTGGAACTTACGATGGATGTC ATTTTATTGGCTGGAGTTTACGATGAATGTCATTTTATTGGCAGATGCAA ATTACAACAGGATATAATCACACCTTGGCAATCAGCAACTCCTCCGTCTA TTCTTGCGGTTCTTCTTTGTTTGGCGTACTTGGCCAAGGGTCTGAAAAAA CAGTGTTCAGCATTTACCCGAATCAATTTCCCACCTTTGGCGCGTGTGGC ACATGTTTCGGCCTCAAATAGTGATGCAGTTTTTGTTATGCAGTCTGGAG AGGTTTGTAGCTACTTAACCTTTATTCAACTAGTTTGAGTCATTAGCAAG TCATTAATCTGGGAATAATTACTCTGCCTGTTCCATTATTGCTTTATGTT ATTGGAATTGAAACCAACAGTTTTAGATTGTAAAATGATCAATACTTGTT TCCATTGTGAACCTGCCATTTCACTTTGCAGGTATTTACATGTGGGAGTA ATTCATATTCGTGCTGTGGACATGGAGATACAAGTCAAATAATTTTCAGG CCGCGTCTTGTTGAATCCTTAAAGGGGATTCCTTGCAAGCAGGTAAACTG CATATTTTTATTCTGTTCTCTTTTGCTAATTTTTTTCATCTTAGTCTGAT ATATTATAAAGTTGGCAGTCAAGTCTTTCCATGTAGTCTGCAATAAATTG AATTCTATAGTTCCAATCAGTCACATAATTTCCTGAAGTATATAGGGAAA TGCGAGTTGGTTTTCACGTAACAATTTGCGGTGCTTTTCCGAATACATTC GTCGAAATTTTTTCCATGTAATTTTAATTTATAGTTAGGTAAACAAAATT TATTGATAGCGTACCAATAACGAATCGACTATATATACCCACATACCTGA TATTTTGAGGCTCACGTACCATTGAAGATAACTGCAAACCTGGTGACCAA GGTTTCGATTTCTTACAAGTAATTTTGAGGGGGTTCTTATCCCTTTCATA TACAATTTAGATTTTTAAATGGGCACCTGCATTTTGAGAAGTTCCAAAAA TTGCTGTCTGTCCTTTTGTTTTGATTGAATCCATCATCCTAGGGTCGAGG CACCGATTAAATGGGAGGCAAAACCAAGCATACTAGGGTTCCGAGAGTTG GAGATGGTGCTAGGGCATAGAGCAACAAGCTAGCAGTTGGTAAAGTGAGA AGAGTAATGTGGTGGTTTGACATTGCATCACTTGTAAAGACGAAGTGGTT CACCTCGTTGTGGCATGACATAATGCAGGGTATAGAACTTCCAGTGGCGA GAGCTGGGTGTCATCGGGGGTAAGAATCGATTGGTGCTTGGATTAATCAG TCCATTGAAGTAAGGAGGTTGTGAAGTAAATGAGGAAAATAAAGTTCAAG AACTGACAATGGCTTCCCCTTCTTCATCCATGGTTACTTTGCTTTTTCTC TCGTTTTATTTTGAGATTAAAGAGAATCTTGGAATAGGAAAGATTTGACT ATCGTTTCACACTATTAAAATCGGTGTTTGCGATGATGAAGATGGAAATG AAGAAGATTGGTTGTATAAATTTGAGAAAACATAATGGTTTTCATGATTT ATCAAGGGATATCATGACTGACTTGATGAAGGGGGATATGGCCAATCTAA TGATTTAATGGGGGATTGATTTTCAATTTTAATCAAATGAGATCCTTACT ATAAAAAGGATTGGTTAATAATTACCAATTCCGTGTGTGAAAATGTTGGT CTAGATAGATCACGTGTTTAATAAGTGGTTCATCTCGATCAGCATTTTAG GTTACGGTTTTCCTAACGTATGCAATATTACACACGATAAGGATAAATTA TTTACTCACTTTTTCCTTATTAACTATTCAAATTTAGTGATTCTTAACAT GTGCAATTTTATACACCTTAGGAAAACAGTTCAAGCTAATATCGATCTCA ATTCGCATCGGATGACTAATCTCACTTTAGTCTAATTATCCTTATAAGAA ACCAAGTCCTTTGGGAACCTTCAATTAAACTGTAGCAATCAAGGGCGAAA AACTAAGTCGCAATAACTCAGTTCCTATCAGACCCCTAAGCTCACTTTGG TTCAAATATTTATAATATTTACTACCTTGCAATATGCTTTGATTTCATAT TTATATATTTCAAGGAAGTCTGTGAAAAAGCATTTTGTGATTTCAGTTCC TTACCAAGTTATTTTGAAGGGGGCTCTTGTCTCTTAGATAAAAGTGTTGC AGTTTTGTCATATTGTTGAAACATTATGTGTTGTTCCAAGAAGTTACTCA ATAACAAATCTCGAGTCCAAAAAACTGTCCATTCCAATTGGCATAAGATG TTCCCCCAGTTTGTTGTGATGTGCTCAGTACTATTTTGAATATCTATGAA GGCAATGTCAACTAAATTCTCAAATGTCTTGAGCTAAATTATACTTCTAG TCCCTTAAGTTATTTTTAGGTTTCACCTTATTTTTAAGTTACAAATGTTA GACACTTTGGTCCATTAAGTTTTTCCTTCTATCTGTTTTCTTTTTGAGTC CAACAAATGTTTCATACGTGGCATTGCATTTTGGTGATTCGGCATCTTAC TGAGCAAGAAGAAGAAAAAATAAAAAGAAAACATAGTGTATATAACATTT GTAAATTAAGAGATCAAAATGGAACGGAAAAAACATAATGAACCAAGGTG TCTAAATTTTGCAACTCAAGGAACCAAAATCAAACGAAAAAAACAAAGCG AAACATAAAAATAACTTAAGGACCAAAAGTGTAAGTTATCCCAAAAACTT CACAGCCTTCCTTACTAGACAAGGTCATGTGTATACATGAGGAATAAACT CACGCGGCCAACTTGGTCACGGCGACACTCAGAACATAACAATCCCTAAA ATGATTCAATTCCTCTGTGATGTGGGTCCTGTTGTTCAGGTTGCTGCTGG ATCAGACTATATCTTATCAGTAACAGAAGATGGATCAGTATACTCCTTTG GATCAGGTTATCATTTTTGTCTCGGCCATGGTGAGGATGACAACGAGCTT CTACCACGTTTGATACAAAAATTTAGAAGAAATCGTATTTGTGTTGTCTG CGTATCTGCTGGGGATGAGCGAGCATGCAACTGCACTTGATTCAAATGGA TTTGTGAGTTTCATTTGACAAGATAAATTTTCAATTTTAATTGTCACACT TGATTTGAACTTTTGATGTAGTTGTGAGAATAGATTTCAAGTTTCTATTA TTGATGGTTTAGGTATATACATGGGGCAAGGGATATTGTGGTGCTTTAGG CCATGGAGATGAGATTGAAAGGACAAGACCAGAGATGTTGTCTAGTCTCA AGAATCACTTGGCTATTCAGGTATAAAATTTTCTGAAATTCAAGTCCTTT TCAGTATGTAGTAGCATTGGTGTGTTTCAGGTGTCAGACCCCAACAATGT ATTCAATTTCTTCCATTTTTTATATTGTTATTGGTGTTCACGTGTCAATG TTTGTGTTATTTGTGTTTTATAGTGTTTACATCCAATTATTACGATTTAT GATGAGACTGCTCAGTCCTATTCTTTTCACATTATTGTTACTTGTAGGTG TGTGCAAACCATAGAAAAACCTTTGCTCTACTTGATTCAGGTTTGGTCTA TGGCTTTGGCTCCATTGCATTTGGCAGCCTAGGAATTTTGGGCAAAAGGG TATCTGATATAATATTAAAGCCTAGAATATTAAGTACATTAAGATCTCAC CATGTTTCTCAAATTAGCACTGGTCCTTGTCACGCTGTGGTAGTCACCAA CCGTGGACAAATATTTGGCTTTGGAGACAATGAAAGAGCTCAACTTGGTA AGAGAATGCCATGAGCCTACTGAAATTTTCATAGAAAATTAATCTGAAGA TGATCCTATGTTAGAAAGCAGCATCTGACACATCAAGATAAGTCACATTT TTTTATGTTTGGTTCACCTGAATTTTTAAGTAAGATTATGTTATACTTGT AAAAGTTTAGTGTTTTATATCTTATTACATCCTTCGCACCCAAAATTATT GAAGAGGTGGAATCTATGTTTTTTCTTTTTTGGTGGCTACTTTCAGATGT TGTCCAAATTACATGGGTTATTTGAGGTATTAAATTCTATTATAAAAAAA TGATTGACAATAAATTGAAGGCGC
back to top

Coding sequence (CDS) from alignment at Scc4a34_26:300240..310763-

>MSAD_210094.t1 ID=MSAD_210094.t1|Name=MSAD_210094.t1|organism=Medicago sativa|type=CDS|length=2886bp|location=Sequence derived from alignment at Scc4a34_26:300240..310763- (Medicago sativa)
ATGGCGCAAATTCTGCTACATGGAACTCTTCATGCTACAATCTTTGAGGT
CGATAAACTCAAGAATATTAGTGGTGGTAACATTCTTTCCAAGATAAGAC
AAAACTTTGAGGAGACAGTTGGATTCGGAAAAGGAACTACCAAACTTTAT
GCAACCATTGATTTAGAGAAAGCACGAGTGGGAAGGACCAGAATCATAGA
AAAGGAGCATGTTAATCCTCAATGGAATGAGTCTTTTCACATTTACTGTG
CCCATTTGGCATCGGATATCATATTCACTGTGAAAGATGATAATCCTATT
GGGGCAACCTTAATTGGAAGGGCGTACATTCCTGTTGAGGAGGTATTGGG
TGGTGAGGAAATAGATAGGTGGGTTGAAATATTGGATGTGAATAAAGAAC
CAATTCATGGAAATTCAAAGATCCATGTGAAGCTGCAATTTTTTGATGTT
TCAAAAGACCGCAACTGGGCTCTAGGCATTAGAAGTCCTAAATTTCCTGG
AGTTCCTTATGCTTTCTACACACAAAGACAAGGTTGTAAGGTTTCTCTGT
ACCAAGATTCTCATATCCCAGACAATTTTGTCCCCAATATACAACTTGCA
GGAGGTCAGACTTACCAGCCTCATAGATGTTGGGAGGATGTTTTTGATGC
AATCACAAAAGCAAGGCACTTAATATACATTACAGGGTGGTCTGTTTATA
CTGAGATTTCCTTGGTAAGGGATTCAAGGAGGCCAAAGCCAGGAGGAGAC
ATCACACTTGGTGAGCTTCTCAAGAAAAAAGCACAAGAAGGTGTTAGGGT
ATTAATGCTTGTTTGGGATGATAGAACGTCGGTTCCTCTGTTAAAAAAAG
ATGGGTTGATGGCTACTCATGATCAAGAAACTGAGGAATTCTTCCGAGGC
TCTGAAGTGCACTGTGTCTTATGCCCTCGCAATCCGGATGATGGTGGAAG
CATTGTCCAGAATATAGAAATTGGCACCATGTTTACTCATCATCAGAAAA
TTTTGGTGGTGGACAGTGAGTTGCCAAATGAAGTGGGATTAAATAAACGA
AGAATTGTGAGTTTTGTAGGAGGCATTGATCTCTGTGATGGAAGATATGA
TACCCCGTTTCATTCACTTTTCCGAACTCTGGACACAGCACATCATGATG
ACTTTCATCAGCCTAACTTTCCTGGTGCTTCAATAGAAAAAGGTGGTCCT
AGGGAACCTTGGCATGATATCCACTCAAGGCTTGAAGGTCCCATTGCTTG
GGATGTTTTGTTTAACTTTGAGCAGAGATGGAGGAAGCAAGGTGGAAAGG
ACTTGCTTGTTCCTCTGAGAGAGCTTGAAGATGCCATTATTACCCCATCC
CCAGTAACTTTCCCTGATGATCAAGAGACATGGAATGTTCAGCTATTTAG
ATCTATTGACGGTGGAGCAGCTTTCGGGTTCCCCGAGACTCCTGAAGATG
CTGCTAAAGCTGGGCTTATTAGTGGGAAGGATAACATAATAGATAGGAGT
ATTCAAGATGCTTATATCAATGCTATTCGACGCGCAAAGAATTTCATCTA
CATTGAAAATCAATATTTCCTTGGAAGTTGCTATGCGTGGAGTGCTGATG
GTATTAAGCCTGAAGACATTGGTGCTTTGCATCTGATCCCAAAAGAGCTT
TCACTTAAGATTGTTAGCAAGATTGAAGCTGGGGAAAGGTTCACTGTGTA
TGTTGTGGTTCCCATGTGGCCTGAGGGTGTCCCAGAAAGTGCATCAGTTC
AGGCAATATTAGACTGGCAGAGGAGGACAATGGATATGATGTACAAAGAT
ATTATTGAAGCACTCAATGCCAAGGGAATTGAGGAAGATCCTCGGAACTA
TTTGACGTTCTTCTGCCTTGGCAATCGTGAGGTGGTAAAACAAGGAGAGT
ACGAGCCTCCTGAAAGACCAGAACCTGATTCAGATTATATGCGAGCTCAA
GAGGCCAGGCGTTTCATGATTTATGTTCATGCCAAGATGATGATAGTTGA
TGATGAATACATAATCGTCGGATCTGCCAACATCAACCAAAGATCAATGG
ATGGTGCTAGAGACTCTGAAATTGCAATGGGAGCTTATCAACCCTATCAT
TTAGCTAATAGGCAGCCTGCAAGGGGTCAGATTCATGGTTTCCGCATGTC
GTTGTGGTATGAGCACCTTGGCATGCTTCAAGAAACCTTCCTTCACCCAG
AAAGTGAAGAATGCATTAGGAAGGTGAACCAGATTGCTGACAAATATTGG
GATCTCTATTCTAGCGAGACTCTTGAGCATGATCTCCCTGGCCACCTTCT
CCGCTATCCCATTGGGGTTTCCAGTGAAGGAAGCGTGACAGAGCTGCCAG
GATTTGAATTCTTCCCTGACACCAAGGCTCGTGTTCTTGGCGGAAAAAGA
AAGCTGTATAATCATCGGCGTGGCCGAAATTGGAGGCGAGTTTTGAGGTT
TTTGCAACCTGTTGAACAATCCTCTGATATGGTTGAGATACAATTAGGAA
ATGATATAATCACACCTTGGCAATCAGCAACTCCTCCGTCTATTCTTGCG
GTTCTTCTTTGTTTGGCGTACTTGGCCAAGGGTCTGAAAAAACAGTGTTC
AGCATTTACCCGAATCAATTTCCCACCTTTGGCGCGTGTGGCACATGTTT
CGGCCTCAAATAGTGATGCAGTTTTTGTTATGCAGTCTGGAGAGGTATTT
ACATGTGGGAGTAATTCATATTCGTGCTGTGGACATGGAGATACAAGTCA
AATAATTTTCAGGCCGCGTCTTGTTGAATCCTTAAAGGGGATTCCTTGCA
AGCAGACAAGGTCATGTGTATACATGAGGAATAAACTCACGCGGCCAACT
TGGTCACGGCGACACTCAGAACATAACAATCCCTAA
back to top
Properties
Property NameValue
NotePhospholipase D MAKER:161.4:0.07:Medtr2g103730
AED0.07
QI107|0.55|0.5|1|0.66|0.6|10|939|961
eAED0.07
CADL Non-redundant FlagY
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Gene Ontology Update2017-11-12
Whole Genome Assembly and Annotation of Medicago sativa2016-01-05
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Scc4a34_26supercontigScc4a34_26:300240..310763 -
Gene Ontology
GO Assignments
This mRNA is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0016042 lipid catabolic process
biological_process GO:0046470 phosphatidylcholine metabolic process
cellular_component GO:0016020 membrane
molecular_function GO:0070290 N-acylphosphatidylethanolamine-specific phospholipase D activity
molecular_function GO:0005509 calcium ion binding
molecular_function GO:0004630 phospholipase D activity