MSAD_210043.t1 (mRNA; Medicago sativa )

Overview
NameMSAD_210043.t1
Unique NameMSAD_210043.t1
TypemRNA
OrganismMedicago sativa (alfalfa)
Sequence length1586
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
MSAD_210043MSAD_210043Medicago sativagene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210043.t1MSAD_210043.t1-proteinMedicago sativapolypeptide


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210043.t1:cdsMSAD_210043.t1:cdsMedicago sativaCDS


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210043.t1:exon:16MSAD_210043.t1:exon:16Medicago sativaexon
MSAD_210043.t1:exon:17MSAD_210043.t1:exon:17Medicago sativaexon
MSAD_210043.t1:exon:18MSAD_210043.t1:exon:18Medicago sativaexon
MSAD_210043.t1:exon:19MSAD_210043.t1:exon:19Medicago sativaexon
MSAD_210043.t1:exon:20MSAD_210043.t1:exon:20Medicago sativaexon


Synonyms
The feature 'MSAD_210043.t1' has the following synonyms
Synonym
maker-Scc4a34_16-augustus-gene-0.36-mRNA-1
Sequences
The following sequences are available for this feature:

mRNA sequence

>MSAD_210043.t1 ID=MSAD_210043.t1|Name=MSAD_210043.t1|organism=Medicago sativa|type=mRNA|length=1586bp
ATGGCGGAAGAAGAAAAGAACGACGACGCCATTGACAGACTAAGCAATCT
ACCAGACTCCATACTCCGCCACATCTTCTCCTTCCTCCCTACCAAAACCA
CCATCCAAACAACCCCTCTCATCTCCCGCCGTTATCGCAACCTCTGGAAG
ACTCTCCAAACCTTCGATTTCGACGGCCAATCCGAAGACAAGCACACCGA
GCGTTTCATGTTCTTCTCCATCTTCGTCAACACCGTCCTCGCTCTACGTG
AGTCTCGACGCATACGTAAGTTTCGTCTTTCTTGCTGCCATGTCCGTAAA
GACGTGTTCTACACGTCCTCGATTGATACGTGGGTACGTACCGCCATTGG
ACCAGACCTTGAAGAATTTCATCTCACTTTACGGAATTTCGATGATCTCT
TCAACCTCCCTCTCGCACTCCTCTCTTGTTCTAACCTCGTCTTTCTCCGT
CTTTGCGGTTCCATTTTGTTGCAATTGAAAGACTCTTCGGAGGTTAGCTT
ACCGTCATTGAAGGTGCTGCAACTATCTGTTGCCAATGGATCGGATGCAA
ATTCTGTGAATATCCTTCTCTCTGGCTGCCCCATTCTCGAAAATCTGGAA
CTTTCCTTTTGTCACGATTCTTTCACCAGGCTTCGGGTGCAATCATCCTT
ATTGAAGAGGTTGGAAATCACTTTTGAGAATGAGGCTGGAGGTTGCGTTG
AGATAGACACGCCGGGTCTCAAATACCTAAGCCTGACCAAAATCGAATTT
AGCAATGCCAGTGCGTTTGGAAACCTGTGCAACGTGAAAGAAGCATATCT
TGCTGAATTTCCCATTCTTGAAAGTCAATCTGTTTACCCTTTGTTCAATC
TCTTCCGAGCTCTCTCTGGAATTAAACATCTAACGCTGGATCAATACTTA
ATAGAGAGGCTATTAGATGACCCATATTTAGAGTTTCCAGAATTTTGCTA
TCTGCTTCATCTAGATGTTGGTCTTCCCTGTTTCAACATGATTTTCCTGT
TTGACATGCTTCAGAAATGTCCCATGCTACAAACTTTCATAATTCTCCAA
TGCATGGATGAACCAGTCTTGTATAATTCATCTAAATATGGATGGGTGTG
GAAGCCTAAAACTGTTGCTAAGTGTCTCGAATCACCTTTCTCTGAATGGC
TGGTTAAGCCTGATAGTGTGCCTAAGTGTCTTGCATCGCACTTGACCTTT
ATTGACTATAAAGATTTTCAAGGAAAGAGACAGGAGCTGGAATTTATTCG
CTATGTTTTGCAAAACGGACTTCTTTTGAAGACGATGGTTATTAGTGGAA
TTTATCTGCTGCAGCACCCGGAGGAGTGGGTGGAATTAATTTCTAATCTG
CCAAGAGGATCTGCCATGTGCCAACTTCAATTTAACTGAGATGTATCACG
AAAAGCAAAAAAGAAGACACATGTGGAACGAAGACTGATAAAGAGGATAC
TTTAGAAGCATAGAAAGACTCAAAATACATAGCTACTGGTTGAAACATTT
GTTGTTGATTGATCGGTTTAGAAGAGTTTGAAGTTCAATATTTTATTTGT
TGTGGAAAATATTTCATTTTGTAAAGTGTATGGGAT
back to top

protein sequence of MSAD_210043.t1

>MSAD_210043.t1-protein ID=MSAD_210043.t1-protein|Name=MSAD_210043.t1|organism=Medicago sativa|type=polypeptide|length=463bp
MAEEEKNDDAIDRLSNLPDSILRHIFSFLPTKTTIQTTPLISRRYRNLWK
TLQTFDFDGQSEDKHTERFMFFSIFVNTVLALRESRRIRKFRLSCCHVRK
DVFYTSSIDTWVRTAIGPDLEEFHLTLRNFDDLFNLPLALLSCSNLVFLR
LCGSILLQLKDSSEVSLPSLKVLQLSVANGSDANSVNILLSGCPILENLE
LSFCHDSFTRLRVQSSLLKRLEITFENEAGGCVEIDTPGLKYLSLTKIEF
SNASAFGNLCNVKEAYLAEFPILESQSVYPLFNLFRALSGIKHLTLDQYL
IERLLDDPYLEFPEFCYLLHLDVGLPCFNMIFLFDMLQKCPMLQTFIILQ
CMDEPVLYNSSKYGWVWKPKTVAKCLESPFSEWLVKPDSVPKCLASHLTF
IDYKDFQGKRQELEFIRYVLQNGLLLKTMVISGIYLLQHPEEWVELISNL
PRGSAMCQLQFN.
back to top

mRNA from alignment at Scc4a34_16:27394..31435-

Legend: CDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>MSAD_210043.t1 ID=MSAD_210043.t1|Name=MSAD_210043.t1|organism=Medicago sativa|type=mRNA|length=4042bp|location=Sequence derived from alignment at Scc4a34_16:27394..31435- (Medicago sativa)
ATGGCGGAAGAAGAAAAGAACGACGACGCCATTGACAGACTAAGCAATCT ACCAGACTCCATACTCCGCCACATCTTCTCCTTCCTCCCTACCAAAACCA CCATCCAAACAACCCCTCTCATCTCCCGCCGTTATCGCAACCTCTGGAAG ACTCTCCAAACCTTCGATTTCGACGGCCAATCCGAAGACAAGCACACCGA GCGTTTCATGTTCTTCTCCATCTTCGTCAACACCGTCCTCGCTCTACGTG AGTCTCGACGCATACGTAAGTTTCGTCTTTCTTGCTGCCATGTCCGTAAA GACGTGTTCTACACGTCCTCGATTGATACGTGGGTACGTACCGCCATTGG ACCAGACCTTGAAGAATTTCATCTCACTTTACGGAATTTCGATGATCTCT TCAACCTCCCTCTCGCACTCCTCTCTTGTTCTAACCTCGTCTTTCTCCGG TAAAACTTCCTTCCCTTATTGTTGTTCAGGGTTATGTAAAAAAGTATTCA TTTTTGGAGTAATAGTCGTTTTGGACCTTGAATGTGTAATTAAATGTGTA ACGAGTATTTATAATAGTCTGTCCATGTATCGAAATTCAAAAATAGTCCA TATGCACTCTGTCCGTTTTTTTCCAAATCAAAAACATCTTTTGTGTTGCA ATGATGATGACATAACATTCATGTAATGTAATGCAATGCCTTAATCTATG GGTTGCAATGATGATAACATAACATTCATGTAATGTGCCTTTAGTTTTTG TGGTTCCATTTTGTTGCAATAATGATGACATAACATTCATATAATGTAAT GTACCTCAGTCTTTGCGGTTCCATTTTGTTGCAATTGAAAGACTCTTCGG AGGTTAGCTTACCGTCATTGAAGGTGCTGCAACTATCTGTTGCCAATGGA TCGGATGCAAATTCTGTGAATATCCTTCTCTCTGGCTGCCCCATTCTCGA AAATCTGGAACTTTCCTTTTGTCACGATTCTTTCACCAGGCTTCGGGTGC AATCATCCTTATTGAAGAGGTTGGAAATCACTTTTGAGAATGAGGCTGGA GGTTGCGTTGAGATAGACACGCCGGGTCTCAAATACCTAAGCCTGACCAA AATCGAATTTAGCAATGCCAGTGCGTTTGGAAACCTGTGCAACGTGAAAG AAGCATATCTTGCTGAATTTCCCATTCTTGAAAGTCAATCTGTTTACCCT TTGTTCAATCTCTTCCGAGCTCTCTCTGGAATTAAACATCTAACGCTGGA TCAATACTTAATAGAGGTGACCGAAAAGTTTTCTATATTTATATGTTTTA ATTATATATGTACTGTTTACTAATATTACATAATCACTTGCTGTTTTTTG TGTATAAGCAGAGGCTATTAGATGACCCATATTTAGAGTTTCCAGAATTT TGCTATCTGCTTCATCTAGATGTTGGTCTTCCCTGTTTCAACATGATTTT CCTGTTTGACATGCTTCAGAAATGTCCCATGCTACAAACTTTCATAATTC TCCAATGCATGGTTTGTCCAGTTCAACTAAAGCTTTGGTGCATGCTGTCC TTTATGTTTGGTTCTAATGTGAGCTGTCCCTTTTTTCCAACAGGATGAAC CAGTCTTGTATAATTCATCTAAATATGGATGGGTGTGGAAGCCTAAAACT GTTGCTAAGTGTCTCGAATCACCTTTCTCTGAATGGCTGGTTAAGCCTGA TAGTGTGCCTAAGTGTCTTGCATCGCACTTGACCTTTATTGACTATAAAG ATTTTCAAGGAAAGAGACAGGAGCTGGAATTTATTCGCTATGTTTTGCAA AACGGACTTCTTTTGAAGACGATGGTTATTAGTGGAATTTATCTGCTGCA GCACCCGGAGGAGTGGGTGGAATTAATTTCTAATCTGCCAAGAGGATCTG CCATGTGCCAACTTCAATTTAACTGAGATGTATCACGAAAAGGTGCGAGC TTTCACCTTGTTTATTTTATGTGGCTTTCTGAATCAGAAACATGCTTAGC CTTCACTATTACCTGTCCCTTCTTTTTACATGCATTGTGTGGTGGAATAT GATAAATTCATACCCCTAGTCCTAGACAATTTAATTTCTTTGATCTAATT ATTTTCTCATAACTAAATCTGAGGAAAAGAAGCTTACAAATACAATCAGG CTTGGGGGCAGAAGCTAGAGTTTTTGTAGGCAGTTTATATAATTATTAGC AAGAGTGATGCTATTTATCTCCAAAAAAAACACATCACGAAGGTACAACG AATGAAAGATAAGCGTTAGATCATTGAATTGTTAGAATAAACGGGGTAGA TGGTAATGAAAAACTCAAAGCTGCAGTTACACTTACACCCATCGTGATGT TGTCGTGAGAAAAGTTTTTGCGAAACATAGCATTTTCCTATTAGTAATTG TCGTATGTGCAGTAACTCCTTTGTAACTATTGTAGGAAATTAGAATATGA GTAATTGATAGCAAAAGGCATTATTTGATGGGAAGGCAGTTCAGATGGGC TTTTAAATTGACGAGAACGGATTTCGAAATCAAATACAAACCTCAGTGTG ACAGTAAACCTGATGATGATGCACTAGCTAGAAGGATGACTTTCACAACC ATTTCAGTAGTGCATTTTTCAAATTTAGACGAGTGGGAAGATGATGCACA GATCGTTTCACGTTTCGACAATAGGAGACCATTCTTGATAGCATCCCTAG TATATCCAACGGATATGGAAAAATATTCAACAACTGGTAACAACTTGTAC AGTCTGTCAACATGACAAGGATCAAACTGTCTCTAGTAGCTAGGTCTCGG AATCCAGCTCAGGTTTGGGATGATACCGTACTAGAGGGAGTGGATTGACT TATTAACTAGGCTCATTTCATTTCCCTTGGCTAGCCTTTTACAGCACGAG ATGTAGCCAAAGTTTTCTTGAAATAAGTGGTAGAATTGCACGGTTTTCCA TCTAGCACTATATCAGATAGGGATAAAAAAATTCTTAGTTGCTAACGGAC TGAATTATTCTGATCAGAATGAACGAAACTTAAATAATGCTTACCATCCA CACTTTGATAGTCAAAGAGAGGTGTTGAATTGATGCGGGAGCTTGTTTAA GGTGTTCGACTAGTTCTAAATCAAAACAGTGGATCAAATGGTTAAGTTGG ACTGAATTCTGGTTCAATACAAATTATAATACTACTCCTAAAAGCTCCCT TTAAGGCTTTTCATCTTAGAGATACCCTCAAACTTCTTAAGGTAAAAACC ATCCCTTCTTTGGTTGAAGAACAGAAGAAGTAAAACAAATGACGACTGAC AGGGAAACCATCCTAAATGATTTGAAAGGTATCAGGGAATTGTAGTCTCT ATTCAGTTCATTAGTTTTATTTCCAACTAGTTCTAACACCTTGTTTGCAA TATTGGAAGCAATCATGCATATTTAAAGATTAGAATTCCAATCATGTTGC TAACATTCTTATACTAGAATCATGAGGTACTATGTGAATAATGAGTAGCA GCTAATTGCCTAGCATGTATGATTTGTTGTTTTTTCAATTGTTACATGTT ATCAATCACTGTTACTGTTAGTCTATAAGTAGTGAATACAATTGTTACAT GTTTTCAATTGGTAATTGGCTATTAGTAGCAATTTCTGATTTCTGCATAC AAGTAGTGGATACAATCTTTTTCTTTGAGAATCAAATTTGCTGTATTTTA CTACCTCTAAGCAAGTTCAATTTCAAATTAGTCAATATGACAAATTTTAA ATCTATACAATGTTCACATGAATGAGTATGTTTTAGTATTGCTTTTCCTT CTGTTATGAGTAATTAGTTTTTGAAATTGTCTCTAATTAATCATTGCTAA TAATTCAACAGCAAAAAAGAAGACACATGTGGAACGAAGACTGATAAAGA GGATACTTTAGAAGCATAGAAAGACTCAAAATACATAGCTACTGGTTGAA ACATTTGTTGTTGATTGATCGGTTTAGAAGAGTTTGAAGTTCAATATTTT ATTTGTTGTGGAAAATATTTCATTTTGTAAAGTGTATGGGAT
back to top

Coding sequence (CDS) from alignment at Scc4a34_16:27394..31435-

>MSAD_210043.t1 ID=MSAD_210043.t1|Name=MSAD_210043.t1|organism=Medicago sativa|type=CDS|length=1389bp|location=Sequence derived from alignment at Scc4a34_16:27394..31435- (Medicago sativa)
ATGGCGGAAGAAGAAAAGAACGACGACGCCATTGACAGACTAAGCAATCT
ACCAGACTCCATACTCCGCCACATCTTCTCCTTCCTCCCTACCAAAACCA
CCATCCAAACAACCCCTCTCATCTCCCGCCGTTATCGCAACCTCTGGAAG
ACTCTCCAAACCTTCGATTTCGACGGCCAATCCGAAGACAAGCACACCGA
GCGTTTCATGTTCTTCTCCATCTTCGTCAACACCGTCCTCGCTCTACGTG
AGTCTCGACGCATACGTAAGTTTCGTCTTTCTTGCTGCCATGTCCGTAAA
GACGTGTTCTACACGTCCTCGATTGATACGTGGGTACGTACCGCCATTGG
ACCAGACCTTGAAGAATTTCATCTCACTTTACGGAATTTCGATGATCTCT
TCAACCTCCCTCTCGCACTCCTCTCTTGTTCTAACCTCGTCTTTCTCCGT
CTTTGCGGTTCCATTTTGTTGCAATTGAAAGACTCTTCGGAGGTTAGCTT
ACCGTCATTGAAGGTGCTGCAACTATCTGTTGCCAATGGATCGGATGCAA
ATTCTGTGAATATCCTTCTCTCTGGCTGCCCCATTCTCGAAAATCTGGAA
CTTTCCTTTTGTCACGATTCTTTCACCAGGCTTCGGGTGCAATCATCCTT
ATTGAAGAGGTTGGAAATCACTTTTGAGAATGAGGCTGGAGGTTGCGTTG
AGATAGACACGCCGGGTCTCAAATACCTAAGCCTGACCAAAATCGAATTT
AGCAATGCCAGTGCGTTTGGAAACCTGTGCAACGTGAAAGAAGCATATCT
TGCTGAATTTCCCATTCTTGAAAGTCAATCTGTTTACCCTTTGTTCAATC
TCTTCCGAGCTCTCTCTGGAATTAAACATCTAACGCTGGATCAATACTTA
ATAGAGAGGCTATTAGATGACCCATATTTAGAGTTTCCAGAATTTTGCTA
TCTGCTTCATCTAGATGTTGGTCTTCCCTGTTTCAACATGATTTTCCTGT
TTGACATGCTTCAGAAATGTCCCATGCTACAAACTTTCATAATTCTCCAA
TGCATGGATGAACCAGTCTTGTATAATTCATCTAAATATGGATGGGTGTG
GAAGCCTAAAACTGTTGCTAAGTGTCTCGAATCACCTTTCTCTGAATGGC
TGGTTAAGCCTGATAGTGTGCCTAAGTGTCTTGCATCGCACTTGACCTTT
ATTGACTATAAAGATTTTCAAGGAAAGAGACAGGAGCTGGAATTTATTCG
CTATGTTTTGCAAAACGGACTTCTTTTGAAGACGATGGTTATTAGTGGAA
TTTATCTGCTGCAGCACCCGGAGGAGTGGGTGGAATTAATTTCTAATCTG
CCAAGAGGATCTGCCATGTGCCAACTTCAATTTAACTGA
back to top
Properties
Property NameValue
NoteF-box/RNI/FBD-like domain protein MAKER:8.5:0.07:Medtr4g032730
AED0.07
QI0|0.75|0.6|1|0.75|0.6|5|197|462
eAED0.07
CADL Non-redundant FlagN
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly and Annotation of Medicago sativa2016-01-05
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Scc4a34_16supercontigScc4a34_16:27394..31435 -