MSAD_210026.t1 (mRNA; Medicago sativa )

Overview
NameMSAD_210026.t1
Unique NameMSAD_210026.t1
TypemRNA
OrganismMedicago sativa (alfalfa)
Sequence length300
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
MSAD_210026MSAD_210026Medicago sativagene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210026.t1MSAD_210026.t1-proteinMedicago sativapolypeptide


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210026.t1:cdsMSAD_210026.t1:cdsMedicago sativaCDS


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210026.t1:exon:50MSAD_210026.t1:exon:50Medicago sativaexon
MSAD_210026.t1:exon:51MSAD_210026.t1:exon:51Medicago sativaexon
MSAD_210026.t1:exon:52MSAD_210026.t1:exon:52Medicago sativaexon


Synonyms
The feature 'MSAD_210026.t1' has the following synonyms
Synonym
maker-Scc4a34_13-augustus-gene-0.48-mRNA-1
Sequences
The following sequences are available for this feature:

mRNA sequence

>MSAD_210026.t1 ID=MSAD_210026.t1|Name=MSAD_210026.t1|organism=Medicago sativa|type=mRNA|length=300bp
ATGAATGGTATTTACTATTTAGTTCCAACATCTGTTAGTAGCCCAACCCT
TGGTGATTTCCTGTTCGACATTGAAACTACTGTGGATCTTGATTGGGGTA
GCAGTAATAACCCTAATGATAGTAATAGTTTCGAGGGAAAGTCCAGAATG
GATGAGCAAATTCAACTTTTCTCCTGGGAACTTCTCTCCATGGGTCTTGG
CTTGCGTAGTTATTGTCTTCACCCGCATGAGAAAGAGAACAAAGGATTTT
CTAACAAAGCGCGGTTGGTGAATCGACTCGTGTTGATGCTTTTGTCGTAG
back to top

protein sequence of MSAD_210026.t1

>MSAD_210026.t1-protein ID=MSAD_210026.t1-protein|Name=MSAD_210026.t1|organism=Medicago sativa|type=polypeptide|length=100bp
MNGIYYLVPTSVSSPTLGDFLFDIETTVDLDWGSSNNPNDSNSFEGKSRM
DEQIQLFSWELLSMGLGLRSYCLHPHEKENKGFSNKARLVNRLVLMLLS.
back to top

mRNA from alignment at Scc4a34_13:10100..11088-

Legend: CDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>MSAD_210026.t1 ID=MSAD_210026.t1|Name=MSAD_210026.t1|organism=Medicago sativa|type=mRNA|length=989bp|location=Sequence derived from alignment at Scc4a34_13:10100..11088- (Medicago sativa)
ATGAATGGTATTTACTATTTAGTTCCAACATCTGTTAGTAGCCCAACCCT TGGTGATTTCCTGTTCGACATTGGTAAGTAGCCTATGTTCATGTATAAGC TCCACTTCAACTCTAAGGCCCATTTCTTCTTTTCAATATTCCGGTCCTGA TCAATTCATCTCTCCCATAGGCTGATGTTTTCTTTTCATCAAAATTGGCT TGGCCCATTAAATAGCAAGCGGGACTTCAGCTTCTTCACCTGGTTGTAAC ACGTTTTACTGCATAAGGAATTTCCAAAGACCTCTTGAAGTTCATCCACG CCATCCTCTTGAGTGGCATTGTTGCCCAAAGTTCCTTGTAAACTCTGCTT GTTGTCAGTTGATTGACGAATCAAAGACGCATTTATATTTGCTTTGTATA AACTGAGCACTTCTTTTAATCATCTAGAATATTAAATATGCATAATCACA TTATCTCTAGAACCTATATACCAATGTTTTTCTCAGATGTGGTTCCTCGT CACGAGGATAGGAAGGGTTAGGTGTTCAATGAACTATTATAATTTAATAT ATAAAGAAAATTACCAACTTTCTCAAAAGCCTGGGGTAATCCATTTTTCA TTTTTCAGATTTTGTGAAGGATTCAGAATTGCAGTAGCAAGTTGTGTAAT TGGATTGAAATTGTTTTCTGATTATTATAACCGATTAAACTTCTAGAAAC TACTGTGGTATGTAAACTTCTAATTCGCTTAAACTTTTATTTTGCAGGAC TCACTAATTAAACCGATTACCAGGATCTTGATTGGGGTAGCAGTAATAAC CCTAATGATAGTAATAGTTTCGAGGGAAAGTCCAGAATGGATGAGCAAAT TCAACTTTTCTCCTGGGAACTTCTCTCCATGGGTCTTGGCTTGCGTAGTT ATTGTCTTCACCCGCATGAGAAAGAGAACAAAGGATTTTCTAACAAAGCG CGGTTGGTGAATCGACTCGTGTTGATGCTTTTGTCGTAG
back to top

Coding sequence (CDS) from alignment at Scc4a34_13:10100..11088-

>MSAD_210026.t1 ID=MSAD_210026.t1|Name=MSAD_210026.t1|organism=Medicago sativa|type=CDS|length=300bp|location=Sequence derived from alignment at Scc4a34_13:10100..11088- (Medicago sativa)
ATGAATGGTATTTACTATTTAGTTCCAACATCTGTTAGTAGCCCAACCCT
TGGTGATTTCCTGTTCGACATTGAAACTACTGTGGATCTTGATTGGGGTA
GCAGTAATAACCCTAATGATAGTAATAGTTTCGAGGGAAAGTCCAGAATG
GATGAGCAAATTCAACTTTTCTCCTGGGAACTTCTCTCCATGGGTCTTGG
CTTGCGTAGTTATTGTCTTCACCCGCATGAGAAAGAGAACAAAGGATTTT
CTAACAAAGCGCGGTTGGTGAATCGACTCGTGTTGATGCTTTTGTCGTAG
back to top
Properties
Property NameValue
NoteUncharacterized protein MAKER:25.8:0.59:
AED0.59
QI0|0|0|0.33|0|0.33|3|0|99
eAED1.00
CADL Non-redundant FlagY
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly and Annotation of Medicago sativa2016-01-05
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Scc4a34_13supercontigScc4a34_13:10100..11088 -