MSAD_210023.t1 (mRNA; Medicago sativa )

Overview
NameMSAD_210023.t1
Unique NameMSAD_210023.t1
TypemRNA
OrganismMedicago sativa (alfalfa)
Sequence length594
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
MSAD_210023MSAD_210023Medicago sativagene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210023.t1MSAD_210023.t1-proteinMedicago sativapolypeptide


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210023.t1:cdsMSAD_210023.t1:cdsMedicago sativaCDS


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210023.t1:exon:2MSAD_210023.t1:exon:2Medicago sativaexon
MSAD_210023.t1:exon:3MSAD_210023.t1:exon:3Medicago sativaexon
MSAD_210023.t1:exon:4MSAD_210023.t1:exon:4Medicago sativaexon
MSAD_210023.t1:exon:5MSAD_210023.t1:exon:5Medicago sativaexon
MSAD_210023.t1:exon:6MSAD_210023.t1:exon:6Medicago sativaexon
MSAD_210023.t1:exon:7MSAD_210023.t1:exon:7Medicago sativaexon


Synonyms
The feature 'MSAD_210023.t1' has the following synonyms
Synonym
snap_masked-Scc4a34_10-processed-gene-0.5-mRNA-1
Sequences
The following sequences are available for this feature:

mRNA sequence

>MSAD_210023.t1 ID=MSAD_210023.t1|Name=MSAD_210023.t1|organism=Medicago sativa|type=mRNA|length=594bp
atgaagatccaagcatctgatggtgtgtccggcttcacggcggcatcacc
atcttcgttccaagctttggttcgtcgctctctgccgccatatgctcgtt
ctgtcccgccgtcccttgaacccaccgtcgccaactgcggtctagtggtg
gttggctcggttctggttgctgtcgttgttgttgtctgtggtggttcggt
tggtcttgagaatggtagagaggttgtgacgctactgttgctggatagtg
cttttgttttgccttctgctgtgttgtgcttatgttcgtttgttctggtg
cttggtcctggttgttccgattctgacggctgcaagtgtggtgactttcc
tccacgattaatcctccctcgtcgtgctcccggatcgttcgtcgtcattt
ggatcgtggtggttctgtttgttcttgcaggtggttgtggtgggcgccgg
tggccttgtatcatcgtgtgttcgggggttgttggcacttggattggttt
ccgtcttgacggccaatccattcgcctaattagagctgtaccacttggac
agttttttcacgatgagagcagtgtttctcatcatgtactgtag
back to top

protein sequence of MSAD_210023.t1

>MSAD_210023.t1-protein ID=MSAD_210023.t1-protein|Name=MSAD_210023.t1|organism=Medicago sativa|type=polypeptide|length=198bp
MKIQASDGVSGFTAASPSSFQALVRRSLPPYARSVPPSLEPTVANCGLVV
VGSVLVAVVVVVCGGSVGLENGREVVTLLLLDSAFVLPSAVLCLCSFVLV
LGPGCSDSDGCKCGDFPPRLILPRRAPGSFVVIWIVVVLFVLAGGCGGRR
WPCIIVCSGVVGTWIGFRLDGQSIRLIRAVPLGQFFHDESSVSHHVL.
back to top

mRNA from alignment at Scc4a34_10:11798..14202-

Legend: CDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>MSAD_210023.t1 ID=MSAD_210023.t1|Name=MSAD_210023.t1|organism=Medicago sativa|type=mRNA|length=2405bp|location=Sequence derived from alignment at Scc4a34_10:11798..14202- (Medicago sativa)
ATGAAGGTTTGTTGTGTTGTTGGGCAATTTTCATCTCACTTCTCAACATG CCTTTCTCACAATAGGGTTGGGTCTTTAGTCAAAGCCTATTTTTTATTTT TTTCTACTAGTTTATCCCTATTGTTTACTGCATACCATTTTGGGCCACCA TTTTCTCTCAGTTTTGGAATTTAGATTTGTAATTCAAATTATAGTAAAAA AATTCTTATCTTGAGTTTGAGGGGGGACGTGTTAAAATAGTTGGAAGATA GGTACAGTTAGTTAAGGTAATTAAAGTTGGTTAAATGTTAAGTAGGTAGT AAGATTTGGTTAGTCAAGTAGTTAGTGTAATTGAGATCTATAAATAAGAC CATCCATGTACTTATTACCCATCTTTTTATTAAGAGAAATGATATTTGTA AAACCACTTTATTGCAATTTTTTGACAACTTTCTCTCTCATACTCACATT ATATTCTTATTTCTCTCTCCTTTTACTCTCTCTATTGTTTTGGACCAATG AAGTGATAAATATTACATCAAATTGTCCAAATGTTGTAATTATCACTACT TCTTTATTAAATGTATCAATTAATCTTCTAATCAAAGCTGAACTCTTTGC TCAATATTCCATTCTCAACTCTAACATTAAATTGAATCACATATATAAAT TAAACCTACTGGGGTTTATATGTTGCAGAGACTTTGACAGTTCTTTAAGT ATCAGTTCGATTCTTCCCAGTATAATTTAGGTGGACTAGTTTGCTTCTTA AAAAAACATAATTAAATGTATACTAATGATACTGTTTAACCGACTTCTCT CCAAATAGTTGGACCTCCTCACCTTATCGCTCCCCCTCTCTCTAACTTTT CAAACTTTCCCAAACAACCTACTCTTTCCTTGCCAATCCAATCATTGCCT CTGCGATGTAGATCCAAGCATCTGATGGTGTGTCCGGCTTCACGGCGGCA TCACCATCTTCGTTCCAAGCTTTGGTTCGTCGCTCTCTGCCGCCATATGC TCGTTCTGTCCCGCCGTCCCTTGAACCCACCGTCGCCAACTGCGGTCTAG TGGTGGTTGGCTCGGTTCTGGTTGCTGTCGTTGTTGTTGTCTGTGGTGGT TCGGTTGGTCTTGAGAATGGTAGAGAGGTTGTGACGCTACTGTTGCTGGA TAGTGCTTTTGTTTTGCCTTCTGCTGTTTTTTTTGTTTGTGTTTTGTTGA TTTTAGGTGTTGTGCTTATGTTCGTTTGTTCTGGTGCTTGGTCCTGGTTG TTCCGATTCTGACGGCTGCAAGTGTGGTGACTTTCCTCCACGATTAATCC TCCCTCGTCGTGCTCCCGGATCGTTCGTCGTCATTTGGATCGTGGTGGTT CTGTTTGTTCTTGCAGGTGGTTGTGGTGGGCGCCGGTGGCCTTGTATCAT CGTGTGTTCGGTTTGTGTTTTCCTTGTGCTTGTTCTTCAGAGGTTGGGAG GTTGGGGAGGGTTGCGGATCTGGTCCTTTTTGCAGTGGTTGTGGTTCATA AAACCTAAAAGGGTCTGGTTCGTTTAACCCGAAAGGGTCTGGTTTCTGAC GTATTGAACTCATCCTTCGATCTGAGTTTTTACGCGTTGTTTGCTCGAAA GAGCATTTTATGCCTGCTATTGATTCAGGGGGTTGTTGGCACTTGGATTG GTTTCCGTCTTGACGGCCAATCCATTCGCCTAGTTTAAACTCTAACTGTT CTATTCAGACGTCCACTTTTCATGTGTCTTTTTTGTAACCTGGTTTCGCG CCCGTACGCGGGTTCGCTGAGTTGCGCTAGTGATTAGTGTATTTTTGTTA AGATAGATTAGAGCTGTACCACTTGGACAGTTTTTTCACGATGTATTCCC GTTTGAGTTTTCTTGGGTCAGGTCCAATGTCCCCCCAATTTTTGTACCTG TTTGTTTTTATTTATTATATTTTCTCTTTGGCTTAAAAAAAAGTATATTA ATGATACTGTTGTAAAAATTAGGACTAAATTATCTCTATAAATAATAACA TCATATAAATAAAAGCATCAATAAAATATTAAAGAGAATAAATAAGAGAG ATTTAAGAAAACTTATCTGTTCTTGAAATTGCGGTGATTTGCAGTCGACA GAATCGAAGTAAACTAACACAAAACCATGGAAGGAGATAACCTGCCAAAC AGTAATCCATTATATAACATGAGGCGTAACAAAGTCACTGTCCTTAAGGA TTTATCCGCCTCATAAGCGCATCTCCTCCCAGGATACAACATGTTCTTCC CTAATATGAATCATATCAGAGGTGATAGAACAACTTGAATCTGTTGGAAC ACTGGAAAAATGTTACCCAAAAAACTCAATATTTTTGAGAGGAGAGAAAT CAATTTTTGTTTATGGTTTTTTTAGGAGAGCAGTGTTTCTCATCATGTAC TGTAG
back to top

Coding sequence (CDS) from alignment at Scc4a34_10:11798..14202-

>MSAD_210023.t1 ID=MSAD_210023.t1|Name=MSAD_210023.t1|organism=Medicago sativa|type=CDS|length=594bp|location=Sequence derived from alignment at Scc4a34_10:11798..14202- (Medicago sativa)
ATGAAGATCCAAGCATCTGATGGTGTGTCCGGCTTCACGGCGGCATCACC
ATCTTCGTTCCAAGCTTTGGTTCGTCGCTCTCTGCCGCCATATGCTCGTT
CTGTCCCGCCGTCCCTTGAACCCACCGTCGCCAACTGCGGTCTAGTGGTG
GTTGGCTCGGTTCTGGTTGCTGTCGTTGTTGTTGTCTGTGGTGGTTCGGT
TGGTCTTGAGAATGGTAGAGAGGTTGTGACGCTACTGTTGCTGGATAGTG
CTTTTGTTTTGCCTTCTGCTGTGTTGTGCTTATGTTCGTTTGTTCTGGTG
CTTGGTCCTGGTTGTTCCGATTCTGACGGCTGCAAGTGTGGTGACTTTCC
TCCACGATTAATCCTCCCTCGTCGTGCTCCCGGATCGTTCGTCGTCATTT
GGATCGTGGTGGTTCTGTTTGTTCTTGCAGGTGGTTGTGGTGGGCGCCGG
TGGCCTTGTATCATCGTGTGTTCGGGGGTTGTTGGCACTTGGATTGGTTT
CCGTCTTGACGGCCAATCCATTCGCCTAATTAGAGCTGTACCACTTGGAC
AGTTTTTTCACGATGAGAGCAGTGTTTCTCATCATGTACTGTAG
back to top
Properties
Property NameValue
NoteTransmembrane protein putative MAKER:33.0:0.37:Medtr8g099425
AED0.37
QI0|0|0|0.5|1|1|6|0|197
eAED0.41
CADL Non-redundant FlagY
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly and Annotation of Medicago sativa2016-01-05
Gene Ontology Update2017-11-12
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Scc4a34_10supercontigScc4a34_10:11798..14202 -
Gene Ontology
GO Assignments
This mRNA is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0016021 integral component of membrane