MSAD_210022.t1 (mRNA; Medicago sativa )

Overview
NameMSAD_210022.t1
Unique NameMSAD_210022.t1
TypemRNA
OrganismMedicago sativa (alfalfa)
Sequence length543
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
MSAD_210022MSAD_210022Medicago sativagene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210022.t1MSAD_210022.t1-proteinMedicago sativapolypeptide


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210022.t1:cdsMSAD_210022.t1:cdsMedicago sativaCDS


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210022.t1:exon:8MSAD_210022.t1:exon:8Medicago sativaexon
MSAD_210022.t1:exon:9MSAD_210022.t1:exon:9Medicago sativaexon
MSAD_210022.t1:exon:10MSAD_210022.t1:exon:10Medicago sativaexon


Synonyms
The feature 'MSAD_210022.t1' has the following synonyms
Synonym
maker-Scc4a34_10-snap-gene-0.8-mRNA-1
Sequences
The following sequences are available for this feature:

mRNA sequence

>MSAD_210022.t1 ID=MSAD_210022.t1|Name=MSAD_210022.t1|organism=Medicago sativa|type=mRNA|length=543bp
ATGTATCAAAGGCTCAAGAACTACAAGAAAAGATCTAGTCAAAGGCTAAG
ATCAAAATCTGATTCCAAACCCAATAGctacaccaatctactgctgaaag
gaaactcagctgctaagtctgcagatatggagaatcatcataggatgctc
ctgaaagaggaggagggtctgaccaacccaaccatgaccacaagctggca
atttacttcatggctaccttcaagaagattaatctcccaagatacattca
tgcatcatttatgttgggcaataaatgaaggcatcaacaaagatagaaag
caagtaccatgtgggaggttgttgtctgaaatcttccaccaaggtaaatt
gctggagattctgaggagatcaaagggtgcttctgataaatgctttaagg
tttctactgttgacaagattatcaatagcaggaccttatattttatgaag
attatcaagaaatttcctcaatgcattccacctctcaacatgattttacc
tgacaatgttgatgttgagtctaacttacataaagcctctgaa
back to top

protein sequence of MSAD_210022.t1

>MSAD_210022.t1-protein ID=MSAD_210022.t1-protein|Name=MSAD_210022.t1|organism=Medicago sativa|type=polypeptide|length=181bp
MYQRLKNYKKRSSQRLRSKSDSKPNSYTNLLLKGNSAAKSADMENHHRML
LKEEEGLTNPTMTTSWQFTSWLPSRRLISQDTFMHHLCWAINEGINKDRK
QVPCGRLLSEIFHQGKLLEILRRSKGASDKCFKVSTVDKIINSRTLYFMK
IIKKFPQCIPPLNMILPDNVDVESNLHKASE
back to top

mRNA from alignment at Scc4a34_10:1161..5719-

Legend: CDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>MSAD_210022.t1 ID=MSAD_210022.t1|Name=MSAD_210022.t1|organism=Medicago sativa|type=mRNA|length=4559bp|location=Sequence derived from alignment at Scc4a34_10:1161..5719- (Medicago sativa)
ATGTATCAAAGGCTCAAGAACTACAAGAAAAGATCTAGTCAAAGGCTAAG ATCAAAATCTGATTCCAAACCCAATAGGTTAAATCTCTGGTGCATGAATA TGACTCGAGTTAACCTGATGTTAATCGAGCAGTCTACGCAAAGCAAAAGA TCATCGTGTATCCTAGAACAGGGTCCTAATCTTTCTGAGCAACTACATGA CAGTTGAGACAGGTCCATGAATTGGTCCATGCCCCATAACAATGAAAGAG GGAGGAAATGTGAATTTGGAGGCAACCGTCAGGCAAGTCATAGGTTACAG GAACTATGGTAATTCCTCTACCTCAATTAATAATGGTTGGTAGATGGTCT TGAATAACCTTTTGAGCATTATCAATTTTGTGATAATGGTTATGATGTGC TTTTGAAAACCCAACTGTACAGTAATCAACAAGGAAGACAAAATCCATTG TGTTCAAGGAAGAGAGTTGACAATGTCTATAAATCAATTTTTCTGAACTG GCTGATCAGAAGGTGTTTGCCTCTATCAGGTGATAAGAAATGGATGTGCC AGAAGGTTGGGACATGCTAACTGGAGGTTAATCTCTAAGCTTAGAGTAAG GGTTACACACTGTGTGAAAGGGCCTAGGCCAGACAATTACTGATTCATTC AGATGAGCTTGTCTGTGGGTAATTGTTACGGAAGGAAACGATGTTGTGAA ATCATGGTAAAATCAAAGGAGCTTCTGCATCAAGATTCGAATCTGACAGA ATAGAATCACAAAAAATTTGAAAGTCAGAATATGATCAATGGTGGAGAAT TGGAAAATTGAGCCATTTGAAGCTTTTGTGAAAACATGGAATTTTTCCAT GATTCTCTTCTCCTAATACACCACAACAATGGGTTGTAGAGAGAAAGAAT AGAAACTTTACAAGAATGGCCAGAACATGATTCAAGAAACAATTTACAAA ACATTTTTTCGGCAAAAGACGCACGTGTACGCAAGGCTATGTTCAAACGG ATCATATTAGACCCTATTTGGAGAAAACAGCATATGAACTCGTTTAAAGG AAGAAAAACCCAATATCTCTTACTTTCATCAATTTGGATGTACATGTTTA CATTCTGAACAACAAGCTCTACCTAAGAAATTTGATGCCAAGGCCCAAAG AGGAATCTTTTTAGGTTACTCTGAAGGTCAAGGCATACAGAGTGTATTCA GAAACACTCTGTGTGAAGAATCTATGCACGTTAAATTTGATGACAAGAGC TTGAAGATAAAACTTCAAAGCAAGGTGAAAGTTTTGCAGAGATACAGGTT CCTGAAGCTACTCCAGAACCTGATCAGATAGCTGAATCTGAAGATAGTCC AGAAGCTGAACCCACATCAGAAGCGCAAGATGAAACTGCTTCTGATGAAG CACAAGATGGCTCACATCAAGCAATCCTCCCAGAAACACATTCAAACACA AGTCTTCACATCCTGAGGAGCTAATCATTGGAAACAAAGATAGTCCAAGA AGAACAAGATCACATTTCAGACAAGAAGAGTCAATGATTGGACTAATCTC AATGATTGAACCTACAACAGTTGATGAAGCACTTTCAGATGATGGATGGA TCCTAGCTATGCAAGAAGAGTTGAATCAATTTCAAAGAAATGATGTGTGG GATCTGGTACCCAAACCTCAGCACAAGAACATTATTGGAACAAAATGGGT ATTCAGAAACAAGCTGAATGAGCAAGGTGAAGTAACAAGAAACAAAGCCA GACTTGTTGCACAAGGGTATAGTCAACAAGAAGGCATTGATTACACTGAA ACGTTTGCTCCAGTTGCAAGATTGGAAGCAATCAGGTTACTTCTTTCCTA TGCAGTTAATCATGGCATAATATTATATCAAATGGATGTCAAGAGTGCAT TTCTAATGGTGTCATAGAAGAAGAAGTGTATGTCAAGCAACCTCCTGGAT TTGAGGATATTAAATATCCTGACCATGTTTTTAAACTGAAGAAATCACTA TATGGCTTGAAACAAGCTCCCAGAGCTTGGTATGATAGACTAAGTAATTT CTTAATCAAAAATGATTTTAAAAGAGGACAGGTTGATACTACACTCTTCA GAAGGACCCTTGGGAAAGATATTCTTGTTGTGCAAATATATGTTGATGAT ATAATATTTGGTTCTACTAATGCATCTCTTTGCAAGGAATTTTCTGAGTT AATGCAGGATGAATTTGAAATGAGCATGATGGGAGAGCTGAAGTTCTTCC TTGGCATTCAAATCAATCAATGCAAAGATGGAGTCTATGTTCATCAATCA AAGTACACAAAGGAGCTTCTGAAGAAGTTCAAACTTGAAGATTGTAAAGT GATGAACACTCCAATGCACCTACGTGCACCTTAAGCAAAGAAGATGAAGG AGCTAAAGTAGATCAGAAGCTGTATAGAGGTATGATTGGTTCTTTGTTAT ACCTCACTGCATCTAGGCCAGATATTTTATTCAGTGTATGCTTGTGTGCA AGATTCCAATCAGATCCTAGAGAATCTCATATGACTGCTGTCAAGAGAAT CTTCAGGTATTTGAAAGGAACAACTAATCTTGGACTCCTTTATAGGAAAT CCTTAGATTATAAGCTAATTGGATTCTGTGATGCTGATTATGCTGGTGAT AGGATTGAAAGAAAGTCAACCAGTGGCAATTGTCAATTTCTGGGTGATAA TCTTATATCCTGGGCTAGCAAAAGACAAACAACTATTGCTATGTCTACAG CAGAAGCAGAATACATTTCAGCTGCAAGTTGTTGTACACAACTACTTTGG ATGAAACATCAGTTGGAAGATTATCAGATAACTGCTAACAGTATTCCCAT TTATTGTGATAATACTGCTGCTATTTGTTTGTCTAAAAATCCAATTTTGC ATTCAAGAGCTAAGCACATTGAAATCAAACACCATTTTATCAGAGATTAT GTTCAAAAAGGAATTTTAGATATACAATTCATTGATACTGAAAATCAATG GGCTGATATATTTACTAAGCCTTTAACTGTTGAAAGATTTGATTTTATAA AGAAAAATTTGAACATGCACTTGTGTCTGATTAAACTTGCTTGCTCCTGA ATAGGATTTTAGGTTCTGAAGTTAGTTCAGAAGCAGTTCCATCAGAAGCT CTTTATTGAGGTTCTGAGGAAAACTCGCTTCTGATGATGACGTCAGCATC TGAAGTCCAGAAGCTGGATTTTTGCTTCTGAATAGTTGAATTAGTGGAAA CGTTGGAGTTACTTTTTGTAACTTCTGGCCCACTAACTTGGTAGTTACTC TGTGAACTTCTTACGTGGCCTGTATTGTTTGGTGTATAACTAAAAGGGCA ATGATGATTTAATAGCTTTGAAAGTACTTTTCACGCGCCCCCAATTTGTC ATTAATGTTATGTTTGTTTGTCTCTTTTGAATTGCAATCGTTTTACTTTT AACACTTTGTCAATTCACACACTACTACTCACTCACAACAAACACTTCTC TTTCAAACCTTTCTTGCGAAGTAAGCGCATTCTTAACCTTAGAACCCTAA AAATCTTCATCTTCATCAAATGGCAACTTCAACAAGTGGTTCCAGCATGC AACAACAAGGCACATCAGGATCTGGGTCTGTAAGCAAGCAAAGAAAATGA CTATTCCACTAAAATCTTTGATCGTTCAAATAGAATTGCCAGTGGATTTC GATTCTCTCAAGAAATACAAGGTAGACATGAAAGCGTTGGTAGAAGCTCA GTAACTGTTCGATTACTTTCATATGTTGAATGGACCAACGTATGAAAATC TTGTCAAAGACTTCTAGGTTAGGGCTGAAGTCTACAATGAGAAAGGTGTG AAGATAGAAGAAAGACAAGCAGTGTCCATAAAGGCTAATCTGAAGGGAAA GACCAAAAAGGAAAAGGGTCTTAAACCGGTCAATGGTTTAGAGATCAGGT CATCAGTGATGGGTATTCCAGTAACCATCACAGAAGAAGCTATTGCTAAA GCTTGCAGGGTAGCTCCTGAAGGCAGATTCCAGTGGGATGTCAGCAAAGA TGATATCTTGTTGGAAAGCTACACCAATCTACTGCTGAAAGGAAACTCAG CTGCTAAGTCTGCAGATATGGAGAATCATCATAGGATGCTCCTGAAGTTC TATACAGATTGCTTCTTTCAGAGAGGAGGAGGGTCTGACCAACCCAACCA TGACCACAAGCTGGCAATTTACTTCATGGCTACCTTCAAGAAGATTAATC TCCCAAGATACATTCATGCATCATTTATGTTGGGCAATAAATGAAGGCAT CAACAAAGATAGAAAGCAAGTACCATGTGGGAGGTTGTTGTCTGAAATCT TCCACCAAGGTAAATTGCTGGAGATTCTGAGGAGATCAAAGGGTGCTTCT GATAAATGCTTTAAGGTTTCTACTGTTGACAAGATTATCAATAGCAGGAC CTTATATTTTATGAAGATTATCAAGAAATTTCCTCAATGCATTCCACCTC TCAACATGATTTTACCTGACAATGTTGATGTTGAGTCTAACTTACATAAA GCCTCTGAA
back to top

Coding sequence (CDS) from alignment at Scc4a34_10:1161..5719-

>MSAD_210022.t1 ID=MSAD_210022.t1|Name=MSAD_210022.t1|organism=Medicago sativa|type=CDS|length=543bp|location=Sequence derived from alignment at Scc4a34_10:1161..5719- (Medicago sativa)
ATGTATCAAAGGCTCAAGAACTACAAGAAAAGATCTAGTCAAAGGCTAAG
ATCAAAATCTGATTCCAAACCCAATAGCTACACCAATCTACTGCTGAAAG
GAAACTCAGCTGCTAAGTCTGCAGATATGGAGAATCATCATAGGATGCTC
CTGAAAGAGGAGGAGGGTCTGACCAACCCAACCATGACCACAAGCTGGCA
ATTTACTTCATGGCTACCTTCAAGAAGATTAATCTCCCAAGATACATTCA
TGCATCATTTATGTTGGGCAATAAATGAAGGCATCAACAAAGATAGAAAG
CAAGTACCATGTGGGAGGTTGTTGTCTGAAATCTTCCACCAAGGTAAATT
GCTGGAGATTCTGAGGAGATCAAAGGGTGCTTCTGATAAATGCTTTAAGG
TTTCTACTGTTGACAAGATTATCAATAGCAGGACCTTATATTTTATGAAG
ATTATCAAGAAATTTCCTCAATGCATTCCACCTCTCAACATGATTTTACC
TGACAATGTTGATGTTGAGTCTAACTTACATAAAGCCTCTGAA
back to top
Properties
Property NameValue
NoteUncharacterized protein MAKER:5.1:0.41:Medtr3g047490
AED0.41
QI0|0|0|0.66|0|0.66|3|0|181
eAED0.55
CADL Non-redundant FlagY
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly and Annotation of Medicago sativa2016-01-05
Gene Ontology Update2017-11-12
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Scc4a34_10supercontigScc4a34_10:1161..5719 -
Gene Ontology
GO Assignments
This mRNA is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0016021 integral component of membrane