MSAD_210021.t1 (mRNA; Medicago sativa )

Overview
NameMSAD_210021.t1
Unique NameMSAD_210021.t1
TypemRNA
OrganismMedicago sativa (alfalfa)
Sequence length666
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
MSAD_210021MSAD_210021Medicago sativagene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210021.t1MSAD_210021.t1-proteinMedicago sativapolypeptide


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210021.t1:cdsMSAD_210021.t1:cdsMedicago sativaCDS


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210021.t1:exon:0MSAD_210021.t1:exon:0Medicago sativaexon
MSAD_210021.t1:exon:1MSAD_210021.t1:exon:1Medicago sativaexon


Synonyms
The feature 'MSAD_210021.t1' has the following synonyms
Synonym
maker-Scc4a34_10-augustus-gene-0.7-mRNA-1
Sequences
The following sequences are available for this feature:

mRNA sequence

>MSAD_210021.t1 ID=MSAD_210021.t1|Name=MSAD_210021.t1|organism=Medicago sativa|type=mRNA|length=666bp
atggatgttgattctgaggatgatcaagatgatcaagcctctgacatggt
tatagacactttttctgaccaaccttcaaccagcaatcctgaaaccacaa
atggccaatcatcatctcatctagccattgtacctacagcttcaccaaaa
ccttctaaacaaccttcaccacccaccagattcctgggtccacatgtatt
acaaggtgtgtgtgaggacattgctgctgagttaatcaagctgatagaag
ggagaagtgacttgggtcacaaagtcagttatcaaaagcagtggaggaga
ctgaatcttgatgatatacatgtccttggaacctgggtgaagaatccact
gagcataagaggaagagatcctacaaattttcttcctaaatttattcacc
ctaaggatctggatttgtcactcctttctaaggtcaatttgagtaaggct
gcacctgatctggctctagttcagaagaataaggtgttagaagaaaggaa
caaggaactggaaagagagctacatgaacataagataatgttgttagagt
tcaaagccgaaacagatgctaagctggaagaagctagactcagagaagaa
aggctcaagtcagagatggatcataaacttgcagaaacaaaagagctact
gaagaagatcttatag
back to top

protein sequence of MSAD_210021.t1

>MSAD_210021.t1-protein ID=MSAD_210021.t1-protein|Name=MSAD_210021.t1|organism=Medicago sativa|type=polypeptide|length=222bp
MDVDSEDDQDDQASDMVIDTFSDQPSTSNPETTNGQSSSHLAIVPTASPK
PSKQPSPPTRFLGPHVLQGVCEDIAAELIKLIEGRSDLGHKVSYQKQWRR
LNLDDIHVLGTWVKNPLSIRGRDPTNFLPKFIHPKDLDLSLLSKVNLSKA
APDLALVQKNKVLEERNKELERELHEHKIMLLEFKAETDAKLEEARLREE
RLKSEMDHKLAETKELLKKIL.
back to top

mRNA from alignment at Scc4a34_10:88..858-

Legend: CDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>MSAD_210021.t1 ID=MSAD_210021.t1|Name=MSAD_210021.t1|organism=Medicago sativa|type=mRNA|length=771bp|location=Sequence derived from alignment at Scc4a34_10:88..858- (Medicago sativa)
ATGGATGTTGATTCTGAGGATGATCAAGATGATCAAGCCTCTGACATGGT TATAGACACTTTTTCTGACCAACCTTCAACCAGCAATCCTGAAACCACAA ATGGCCAATCATCATCTCATCTAGCCATTGTACCTACAGCTTCACCAAAA CCTTCTAAACAACCTTCACCACCCACCAGATTCCTGGGTCCACATGTATT ACAAGGTGTGTGTGAGGACATTGCTGCTGAGTTAATCAAGCTGATAGAAG GGAGAAGTGACTTGGGTCACAAAGTCAGTTATCAAAAGCAGTGGAGGAGA CTGAAGTAAAGAGTTCTTAATGTTATTTCAGCACTGCATGATTCCTGTAT TGAAGCTCAAGAGCAAGCCAAGCAGAAGTTGGAAGATTGACTGAATGGTG TTGAAGAAAGTCTTGATGATATACATGTCCTTGGAACCTGGGTGAAGAAT CCACTGAGCATAAGAGGAAGAGATCCTACAAATTTTCTTCCTAAATTTAT TCACCCTAAGGATCTGGATTTGTCACTCCTTTCTAAGGTCAATTTGAGTA AGGCTGCACCTGATCTGGCTCTAGTTCAGAAGAATAAGGTGTTAGAAGAA AGGAACAAGGAACTGGAAAGAGAGCTACATGAACATAAGATAATGTTGTT AGAGTTCAAAGCCGAAACAGATGCTAAGCTGGAAGAAGCTAGACTCAGAG AAGAAAGGCTCAAGTCAGAGATGGATCATAAACTTGCAGAAACAAAAGAG CTACTGAAGAAGATCTTATAG
back to top

Coding sequence (CDS) from alignment at Scc4a34_10:88..858-

>MSAD_210021.t1 ID=MSAD_210021.t1|Name=MSAD_210021.t1|organism=Medicago sativa|type=CDS|length=666bp|location=Sequence derived from alignment at Scc4a34_10:88..858- (Medicago sativa)
ATGGATGTTGATTCTGAGGATGATCAAGATGATCAAGCCTCTGACATGGT
TATAGACACTTTTTCTGACCAACCTTCAACCAGCAATCCTGAAACCACAA
ATGGCCAATCATCATCTCATCTAGCCATTGTACCTACAGCTTCACCAAAA
CCTTCTAAACAACCTTCACCACCCACCAGATTCCTGGGTCCACATGTATT
ACAAGGTGTGTGTGAGGACATTGCTGCTGAGTTAATCAAGCTGATAGAAG
GGAGAAGTGACTTGGGTCACAAAGTCAGTTATCAAAAGCAGTGGAGGAGA
CTGAATCTTGATGATATACATGTCCTTGGAACCTGGGTGAAGAATCCACT
GAGCATAAGAGGAAGAGATCCTACAAATTTTCTTCCTAAATTTATTCACC
CTAAGGATCTGGATTTGTCACTCCTTTCTAAGGTCAATTTGAGTAAGGCT
GCACCTGATCTGGCTCTAGTTCAGAAGAATAAGGTGTTAGAAGAAAGGAA
CAAGGAACTGGAAAGAGAGCTACATGAACATAAGATAATGTTGTTAGAGT
TCAAAGCCGAAACAGATGCTAAGCTGGAAGAAGCTAGACTCAGAGAAGAA
AGGCTCAAGTCAGAGATGGATCATAAACTTGCAGAAACAAAAGAGCTACT
GAAGAAGATCTTATAG
back to top
Properties
Property NameValue
NoteUncharacterized protein MAKER:0.0:0.35:Medtr7g047000
AED0.35
QI0|0|0|0.5|1|1|2|0|221
eAED0.35
CADL Non-redundant FlagY
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly and Annotation of Medicago sativa2016-01-05
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Scc4a34_10supercontigScc4a34_10:88..858 -