MSAD_210012.t1 (mRNA; Medicago sativa )

Overview
NameMSAD_210012.t1
Unique NameMSAD_210012.t1
TypemRNA
OrganismMedicago sativa (alfalfa)
Sequence length225
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
MSAD_210012MSAD_210012Medicago sativagene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210012.t1MSAD_210012.t1-proteinMedicago sativapolypeptide


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210012.t1:exon:21MSAD_210012.t1:exon:21Medicago sativaexon
MSAD_210012.t1:exon:22MSAD_210012.t1:exon:22Medicago sativaexon


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210012.t1:cdsMSAD_210012.t1:cdsMedicago sativaCDS


Synonyms
The feature 'MSAD_210012.t1' has the following synonyms
Synonym
maker-Scc4a34_9-snap-gene-0.7-mRNA-1
Sequences
The following sequences are available for this feature:

mRNA sequence

>MSAD_210012.t1 ID=MSAD_210012.t1|Name=MSAD_210012.t1|organism=Medicago sativa|type=mRNA|length=225bp
atggaagtcgtagatatgctcgttagatttcctaggaactattacatgct
tcgattcgataaggctaggccactttatgccctttttagtgaaagaaaaa
gggtcaaaaacgagaactattacatgcttcgattcgataaggctaggcca
ctttatgccctttttagtgaaagaaaaaggtcaaaaacgagtaaaatccg
taaattaacaaggaaattcacttaa
back to top

protein sequence of MSAD_210012.t1

>MSAD_210012.t1-protein ID=MSAD_210012.t1-protein|Name=MSAD_210012.t1|organism=Medicago sativa|type=polypeptide|length=75bp
MEVVDMLVRFPRNYYMLRFDKARPLYALFSERKRVKNENYYMLRFDKARP
LYALFSERKRSKTSKIRKLTRKFT.
back to top

mRNA from alignment at Scc4a34_9:2190..2523+

Legend: exonCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>MSAD_210012.t1 ID=MSAD_210012.t1|Name=MSAD_210012.t1|organism=Medicago sativa|type=mRNA|length=334bp|location=Sequence derived from alignment at Scc4a34_9:2190..2523+ (Medicago sativa)
atggaagtcgtagatatgctcgttagatttcctaggaactattacatgct tcgattcgataaggctaggccactttatgccctttttagtgaaagaaaaa gggtcaaaaacgagtaaaatccgtaaattaacaaggaaattcacttaacc cccattttggccgtttttgaaaattctaaaatcaaccatggaagtcgtag atatgctcgttagatttcctaggaactattacatgcttcgattcgataag gctaggccactttatgccctttttagtgaaagaaaaaggtcaaaaacgag taaaatccgtaaattaacaaggaaattcacttaa
back to top

Coding sequence (CDS) from alignment at Scc4a34_9:2190..2523+

>MSAD_210012.t1 ID=MSAD_210012.t1|Name=MSAD_210012.t1|organism=Medicago sativa|type=CDS|length=225bp|location=Sequence derived from alignment at Scc4a34_9:2190..2523+ (Medicago sativa)
atggaagtcgtagatatgctcgttagatttcctaggaactattacatgct
tcgattcgataaggctaggccactttatgccctttttagtgaaagaaaaa
gggtcaaaaacgagaactattacatgcttcgattcgataaggctaggcca
ctttatgccctttttagtgaaagaaaaaggtcaaaaacgagtaaaatccg
taaattaacaaggaaattcacttaa
back to top
Properties
Property NameValue
NoteUncharacterized protein MAKER:0.0:0.48:Medtr2g084470
AED0.48
QI0|0|0|1|0|0|2|0|74
eAED0.55
CADL Non-redundant FlagN
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly and Annotation of Medicago sativa2016-01-05
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Scc4a34_9supercontigScc4a34_9:2190..2523 +