MSAD_210008.t1 (mRNA; Medicago sativa )

Overview
NameMSAD_210008.t1
Unique NameMSAD_210008.t1
TypemRNA
OrganismMedicago sativa (alfalfa)
Sequence length234
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
MSAD_210008MSAD_210008Medicago sativagene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210008.t1MSAD_210008.t1-proteinMedicago sativapolypeptide


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210008.t1:exon:1MSAD_210008.t1:exon:1Medicago sativaexon


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210008.t1:cdsMSAD_210008.t1:cdsMedicago sativaCDS


Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Scc4a34_7supercontigScc4a34_7:30296..30529 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly and Annotation of Medicago sativa2016-01-05
Properties
Property NameValue
NoteReceptor-like protein MAKER:32.5:0.41:Medtr4g032320
AED0.41
QI0|-1|0|1|-1|1|1|0|78
eAED0.41
CADL Non-redundant FlagN
Sequences
The following sequences are available for this feature:

mRNA sequence

>MSAD_210008.t1 ID=MSAD_210008.t1|Name=MSAD_210008.t1|organism=Medicago sativa|type=mRNA|length=234bp
ATGCCATCCTCACTTTCAAACCTTCAACATCTCATTCAGTTTGATCTTGC
ATCCAATTCATTTAGCGGTGAAATCCCAGATGTGTTTGGTGGGATGACAA
AACTGCAAGAACTCTACTTAGATTCTAACAATTTAGAAGGACAAATTCCA
TCTTCACTATTCAACTTGTCTCAACTTGTTGGATTATTTTGTTCTGATAA
CAAATTAGAGGGTCCTCTGCCCAACCAAATTATA
back to top

protein sequence of MSAD_210008.t1

>MSAD_210008.t1-protein ID=MSAD_210008.t1-protein|Name=MSAD_210008.t1|organism=Medicago sativa|type=polypeptide|length=78bp
MPSSLSNLQHLIQFDLASNSFSGEIPDVFGGMTKLQELYLDSNNLEGQIP
SSLFNLSQLVGLFCSDNKLEGPLPNQII
back to top

mRNA from alignment at Scc4a34_7:30296..30529+

Legend: exonCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>MSAD_210008.t1 ID=MSAD_210008.t1|Name=MSAD_210008.t1|organism=Medicago sativa|type=mRNA|length=234bp|location=Sequence derived from alignment at Scc4a34_7:30296..30529+ (Medicago sativa)
ATGCCATCCTCACTTTCAAACCTTCAACATCTCATTCAGTTTGATCTTGC ATCCAATTCATTTAGCGGTGAAATCCCAGATGTGTTTGGTGGGATGACAA AACTGCAAGAACTCTACTTAGATTCTAACAATTTAGAAGGACAAATTCCA TCTTCACTATTCAACTTGTCTCAACTTGTTGGATTATTTTGTTCTGATAA CAAATTAGAGGGTCCTCTGCCCAACCAAATTATA
back to top

Coding sequence (CDS) from alignment at Scc4a34_7:30296..30529+

>MSAD_210008.t1 ID=MSAD_210008.t1|Name=MSAD_210008.t1|organism=Medicago sativa|type=CDS|length=234bp|location=Sequence derived from alignment at Scc4a34_7:30296..30529+ (Medicago sativa)
ATGCCATCCTCACTTTCAAACCTTCAACATCTCATTCAGTTTGATCTTGC
ATCCAATTCATTTAGCGGTGAAATCCCAGATGTGTTTGGTGGGATGACAA
AACTGCAAGAACTCTACTTAGATTCTAACAATTTAGAAGGACAAATTCCA
TCTTCACTATTCAACTTGTCTCAACTTGTTGGATTATTTTGTTCTGATAA
CAAATTAGAGGGTCCTCTGCCCAACCAAATTATA
back to top
Synonyms
The feature 'MSAD_210008.t1' has the following synonyms
Synonym
snap_masked-Scc4a34_7-processed-gene-0.2-mRNA-1