MSAD_210007.t1 (mRNA; Medicago sativa )

Overview
NameMSAD_210007.t1
Unique NameMSAD_210007.t1
TypemRNA
OrganismMedicago sativa (alfalfa)
Sequence length339
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
MSAD_210007MSAD_210007Medicago sativagene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210007.t1MSAD_210007.t1-proteinMedicago sativapolypeptide


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210007.t1:exon:0MSAD_210007.t1:exon:0Medicago sativaexon


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210007.t1:cdsMSAD_210007.t1:cdsMedicago sativaCDS


Synonyms
The feature 'MSAD_210007.t1' has the following synonyms
Synonym
augustus_masked-Scc4a34_7-processed-gene-0.0-mRNA-1
Sequences
The following sequences are available for this feature:

mRNA sequence

>MSAD_210007.t1 ID=MSAD_210007.t1|Name=MSAD_210007.t1|organism=Medicago sativa|type=mRNA|length=339bp
ATGCCATCCTCACTTTCAAACCTTCAACATCTCATTCAGTTTGATCTTGC
ATCCAATTCATTTAGCGGTGAAATCCCAGATGTGTTTGGTGGGATGACAA
AACTGCAAGAACTCTACTTAGATTCTAACAATTTAGAAGGACAAATTCCA
TCTTCACTATTCAACTTGTCTCAACTTGTTGGATTATTTTGTTCTGATAA
CAAATTAGAGGGTCCTCTGCCCAACCAAATTATAAGGTTCCAAAAGCTAA
CTGATTTGAGATTAAATGACAACTTGCTAAATGGTACAATTCCTACCTCT
TTGAGATTCAATCAAGAAGGCATGTTTCTCTTTCTTTGA
back to top

protein sequence of MSAD_210007.t1

>MSAD_210007.t1-protein ID=MSAD_210007.t1-protein|Name=MSAD_210007.t1|organism=Medicago sativa|type=polypeptide|length=113bp
MPSSLSNLQHLIQFDLASNSFSGEIPDVFGGMTKLQELYLDSNNLEGQIP
SSLFNLSQLVGLFCSDNKLEGPLPNQIIRFQKLTDLRLNDNLLNGTIPTS
LRFNQEGMFLFL.
back to top

mRNA from alignment at Scc4a34_7:14254..14592+

Legend: exonCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>MSAD_210007.t1 ID=MSAD_210007.t1|Name=MSAD_210007.t1|organism=Medicago sativa|type=mRNA|length=339bp|location=Sequence derived from alignment at Scc4a34_7:14254..14592+ (Medicago sativa)
ATGCCATCCTCACTTTCAAACCTTCAACATCTCATTCAGTTTGATCTTGC ATCCAATTCATTTAGCGGTGAAATCCCAGATGTGTTTGGTGGGATGACAA AACTGCAAGAACTCTACTTAGATTCTAACAATTTAGAAGGACAAATTCCA TCTTCACTATTCAACTTGTCTCAACTTGTTGGATTATTTTGTTCTGATAA CAAATTAGAGGGTCCTCTGCCCAACCAAATTATAAGGTTCCAAAAGCTAA CTGATTTGAGATTAAATGACAACTTGCTAAATGGTACAATTCCTACCTCT TTGAGATTCAATCAAGAAGGCATGTTTCTCTTTCTTTGA
back to top

Coding sequence (CDS) from alignment at Scc4a34_7:14254..14592+

>MSAD_210007.t1 ID=MSAD_210007.t1|Name=MSAD_210007.t1|organism=Medicago sativa|type=CDS|length=339bp|location=Sequence derived from alignment at Scc4a34_7:14254..14592+ (Medicago sativa)
ATGCCATCCTCACTTTCAAACCTTCAACATCTCATTCAGTTTGATCTTGC
ATCCAATTCATTTAGCGGTGAAATCCCAGATGTGTTTGGTGGGATGACAA
AACTGCAAGAACTCTACTTAGATTCTAACAATTTAGAAGGACAAATTCCA
TCTTCACTATTCAACTTGTCTCAACTTGTTGGATTATTTTGTTCTGATAA
CAAATTAGAGGGTCCTCTGCCCAACCAAATTATAAGGTTCCAAAAGCTAA
CTGATTTGAGATTAAATGACAACTTGCTAAATGGTACAATTCCTACCTCT
TTGAGATTCAATCAAGAAGGCATGTTTCTCTTTCTTTGA
back to top
Properties
Property NameValue
NoteReceptor-like protein MAKER:22.1:0.24:Medtr4g032320
AED0.24
QI0|-1|0|1|-1|1|1|0|112
eAED0.24
CADL Non-redundant FlagY
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly and Annotation of Medicago sativa2016-01-05
Gene Ontology Update2017-11-12
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Scc4a34_7supercontigScc4a34_7:14254..14592 +
Gene Ontology
GO Assignments
This mRNA is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0016021 integral component of membrane