MSAD_210006.t1 (mRNA; Medicago sativa )

Overview
NameMSAD_210006.t1
Unique NameMSAD_210006.t1
TypemRNA
OrganismMedicago sativa (alfalfa)
Sequence length978
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
MSAD_210006MSAD_210006Medicago sativagene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210006.t1MSAD_210006.t1-proteinMedicago sativapolypeptide


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210006.t1:exon:7MSAD_210006.t1:exon:7Medicago sativaexon
MSAD_210006.t1:exon:8MSAD_210006.t1:exon:8Medicago sativaexon
MSAD_210006.t1:exon:9MSAD_210006.t1:exon:9Medicago sativaexon
MSAD_210006.t1:exon:10MSAD_210006.t1:exon:10Medicago sativaexon
MSAD_210006.t1:exon:11MSAD_210006.t1:exon:11Medicago sativaexon
MSAD_210006.t1:exon:12MSAD_210006.t1:exon:12Medicago sativaexon
MSAD_210006.t1:exon:13MSAD_210006.t1:exon:13Medicago sativaexon


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210006.t1:cdsMSAD_210006.t1:cdsMedicago sativaCDS


Synonyms
The feature 'MSAD_210006.t1' has the following synonyms
Synonym
maker-Scc4a34_6-snap-gene-0.12-mRNA-1
Sequences
The following sequences are available for this feature:

mRNA sequence

>MSAD_210006.t1 ID=MSAD_210006.t1|Name=MSAD_210006.t1|organism=Medicago sativa|type=mRNA|length=978bp
atggcgtctctttcactgctcccaaactcagatgttttgacttttgaggc
ccactcaaccacaaacccaaacaaacacagtactagcatttactttcatt
ctaagtacaaaaggaacagcaacacccttagttgccgttgcacttctccc
atttcaaaatgcagagaccccacgcaacagttgctcaaaggattacctgg
taccacagtatttgaaatttatgtggtagtgcatttgctacgagccaaaa
gaaattcaaagagcagtcctccatctaatgcgattaagagcccaaccaaa
tctgaggctgaaaaaaatgacgaggtgaacagttctattgaggaagcaac
taaacaaggcattaaaagtgtactatattttcttaaggacaaaattccag
gattgcaaattacaataatgaacataaacactgaagaggaaggggcagaa
gtggatgaatttattattccaccgatgcacgaagatagtaataaaactac
atcagtgagaacactgaagaggaagttaataatatggagtcaagcagatg
atgatgcatcggcagaagaacaggatttgcgtgtgaatcattttgttggt
ggagttgtctccagtgagaatgacactcctctgaaaattgaaatacaaga
tacagaaagaaatcattttgtcttgcatattcccgggagaaatgtagacg
atgatactagaaaaaatgaagtctacgaggcagctctagaagcacaagga
atctcacatctcatgtcttctgaagttgtcaaggcaattttggattctaa
caaactctccaagacaattaactcagcgatgcttagcttaatcaaggttg
caaggtgtgtatgtgaactgattaaatatgctatgaataaagctaagaaa
ataagtatactatcagagtatacatcttttagctcaattaccagtccaag
tgacgattcagatccttttgatggcgag
back to top

protein sequence of MSAD_210006.t1

>MSAD_210006.t1-protein ID=MSAD_210006.t1-protein|Name=MSAD_210006.t1|organism=Medicago sativa|type=polypeptide|length=326bp
MASLSLLPNSDVLTFEAHSTTNPNKHSTSIYFHSKYKRNSNTLSCRCTSP
ISKCRDPTQQLLKGLPGTTVFEIYVVVHLLRAKRNSKSSPPSNAIKSPTK
SEAEKNDEVNSSIEEATKQGIKSVLYFLKDKIPGLQITIMNINTEEEGAE
VDEFIIPPMHEDSNKTTSVRTLKRKLIIWSQADDDASAEEQDLRVNHFVG
GVVSSENDTPLKIEIQDTERNHFVLHIPGRNVDDDTRKNEVYEAALEAQG
ISHLMSSEVVKAILDSNKLSKTINSAMLSLIKVARCVCELIKYAMNKAKK
ISILSEYTSFSSITSPSDDSDPFDGE
back to top

mRNA from alignment at Scc4a34_6:14857..16706+

Legend: exonCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>MSAD_210006.t1 ID=MSAD_210006.t1|Name=MSAD_210006.t1|organism=Medicago sativa|type=mRNA|length=1850bp|location=Sequence derived from alignment at Scc4a34_6:14857..16706+ (Medicago sativa)
atggcgtctctttcactgctcccaaactcagatgttttgacttttgaggc ccactcaaccacaaacccaaacaaacacagtactagcatttactttcatt ctaagtacaaaaggaacagcaacacccttagttgccgttgcacttctccc atttcaaaatgcagagaccccacgcagttcttctccaggatggtcccacc cccttagttcaccctccatattttaatgcatggtcttaactcttacggca tgatatgaccgtaagcagtttaattaagctgcttgtccaaaaatagctaa aatgttctaaggcttattagtcttaaaaatatgctaatacaaacaaaaac cggctcatgtgttttctccaacacacactcttttattgttcgaaattcat atgaatttcactaaatgtatgtgagaatccacattatgatttatgccaac caatgaaataaaatgcgataaacaatgtttggtagatttttgttgccaag agttacaccccaaggcatatctttctactttctactttgtcatctggtaa ttagcaatagaggactacgtactgctaatttttgtttgtcacagacagtt gctcaaaggattacctggtaccacagtatttgaaatttatgtggtcaaaa atgctgatgatacatatcaaatgtaggtattgatctaattttcccactaa atgatgcttgtttatttgacatcctgcttctgtgaaatttctttactatt actattattattcctgctatatatgctcatggcatcaagtatgacaggta gtgcatttgctacgagccaaaagaaattcaaagagcagtcctccatctaa tgcgattaagagcccaaccaaatctgaggtagagaatgaaacttcaggag cattaagagaaggctgaaaaaaatgacgaggtgaacagttctattgagga agcaactaaacaaggcattaaaagtgtactatattttcttaaggacaaaa ttccaggattgcaaattacaataatgaacataaacactgaagaggaaggg gcagaagtggatgaatttattattccaccgatgcacgaagatagtaataa aactacatcagtgagaacactgaagaggaagttaataatatggaggtata taatgaggggattatagaagcagtcaagcagatgatgatgcatcggcaga agaacaggatttgcgtgtgaatcattttgttggtggagttgtctccagtg agaatgacactcctgttaaggatagatttattcgccttccagctgaaaat tgaaatacaagatacagaaagaaatcattttgtcttgcatattcccggga gaaatgtagacgatgatactagaaaaaatgaagtctacgaggcagctcta gaagcacaaggaatctcacatctcatgtcttctgaagttgtcaaggcaat tttggattctaacaaactctccaaggttagattgagataaggcaccattg aaaaatgcttttgtatttattctgtttttctgttaaactttatgaaatac cttttatgatgttttattaggctctcctcagatttatgatacttaacgaa caccctttcaagtttcttccagctaatgatttattcctgtggaaccttga aaattttttttcttccagctattatgattttctagacaattaactcagcg atgcttagcttaatcaaggttgcaaggtgtgtatgtgaactgattaaata tgctatgaataaagctaagaaaataagtatactatcagagtatacatctt ttagctcaattaccagtccaagtgacgattcagatccttttgatggcgag
back to top

Coding sequence (CDS) from alignment at Scc4a34_6:14857..16706+

>MSAD_210006.t1 ID=MSAD_210006.t1|Name=MSAD_210006.t1|organism=Medicago sativa|type=CDS|length=978bp|location=Sequence derived from alignment at Scc4a34_6:14857..16706+ (Medicago sativa)
atggcgtctctttcactgctcccaaactcagatgttttgacttttgaggc
ccactcaaccacaaacccaaacaaacacagtactagcatttactttcatt
ctaagtacaaaaggaacagcaacacccttagttgccgttgcacttctccc
atttcaaaatgcagagaccccacgcaacagttgctcaaaggattacctgg
taccacagtatttgaaatttatgtggtagtgcatttgctacgagccaaaa
gaaattcaaagagcagtcctccatctaatgcgattaagagcccaaccaaa
tctgaggctgaaaaaaatgacgaggtgaacagttctattgaggaagcaac
taaacaaggcattaaaagtgtactatattttcttaaggacaaaattccag
gattgcaaattacaataatgaacataaacactgaagaggaaggggcagaa
gtggatgaatttattattccaccgatgcacgaagatagtaataaaactac
atcagtgagaacactgaagaggaagttaataatatggagtcaagcagatg
atgatgcatcggcagaagaacaggatttgcgtgtgaatcattttgttggt
ggagttgtctccagtgagaatgacactcctctgaaaattgaaatacaaga
tacagaaagaaatcattttgtcttgcatattcccgggagaaatgtagacg
atgatactagaaaaaatgaagtctacgaggcagctctagaagcacaagga
atctcacatctcatgtcttctgaagttgtcaaggcaattttggattctaa
caaactctccaagacaattaactcagcgatgcttagcttaatcaaggttg
caaggtgtgtatgtgaactgattaaatatgctatgaataaagctaagaaa
ataagtatactatcagagtatacatcttttagctcaattaccagtccaag
tgacgattcagatccttttgatggcgag
back to top
Properties
Property NameValue
NoteExecuter 1 putative MAKER:9.3:0.36:Medtr3g078020
AED0.36
QI0|0|0|0.57|0.5|0.42|7|0|326
eAED0.45
CADL Non-redundant FlagY
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Gene Ontology Update2017-11-12
Whole Genome Assembly and Annotation of Medicago sativa2016-01-05
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Scc4a34_6supercontigScc4a34_6:14857..16706 +
Gene Ontology
GO Assignments
This mRNA is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0010343 singlet oxygen-mediated programmed cell death
cellular_component GO:0042651 thylakoid membrane