MSAD_210003.t1 (mRNA; Medicago sativa )

Overview
NameMSAD_210003.t1
Unique NameMSAD_210003.t1
TypemRNA
OrganismMedicago sativa (alfalfa)
Sequence length471
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
MSAD_210003MSAD_210003Medicago sativagene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210003.t1MSAD_210003.t1-proteinMedicago sativapolypeptide


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210003.t1:cdsMSAD_210003.t1:cdsMedicago sativaCDS


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210003.t1:exon:7MSAD_210003.t1:exon:7Medicago sativaexon
MSAD_210003.t1:exon:8MSAD_210003.t1:exon:8Medicago sativaexon


Synonyms
The feature 'MSAD_210003.t1' has the following synonyms
Synonym
maker-Scc4a34_3-augustus-gene-0.14-mRNA-1
Sequences
The following sequences are available for this feature:

mRNA sequence

>MSAD_210003.t1 ID=MSAD_210003.t1|Name=MSAD_210003.t1|organism=Medicago sativa|type=mRNA|length=471bp
ATGATTGAAAATGTTGAAGCATTGTCGTCGCAAGTTGAGAATTTGAAAAC
TCGGATTGATAGCGTGAAATATGAAAATCCTGGAAAGTTCTGTTCTGCAA
CTCAATCGAACATAATTGGGCCGTCTAATGGATTTAATCGTTCTGTTCAT
AATTATGGCTCTTTTGCTGGTAAAGAAATTCCAGTTCCAGGTAGTTTTGC
CGGTAAATCTGAGTTATATGCGGAAGATCAACTTATGACTGACGATGTAT
TATCAACTCGAGAAGGGATAACTCCTTCCATCGAATCTGCCAATAGGTCC
CAGTTTGAGGTTCAGGGAGAAAATCTGGAAGAGAAATCCAATGAATCAGT
TGAAGAGCAGAAATGCATTTCTTCAGCTCAAGTTTCAGACTCTGACATGC
TCACTGAGAATGCTGTTCTTAATGCTCATTCTGTTAAACCATGTTCAACA
TCCAAGACTCATTTTCTCTAG
back to top

protein sequence of MSAD_210003.t1

>MSAD_210003.t1-protein ID=MSAD_210003.t1-protein|Name=MSAD_210003.t1|organism=Medicago sativa|type=polypeptide|length=157bp
MIENVEALSSQVENLKTRIDSVKYENPGKFCSATQSNIIGPSNGFNRSVH
NYGSFAGKEIPVPGSFAGKSELYAEDQLMTDDVLSTREGITPSIESANRS
QFEVQGENLEEKSNESVEEQKCISSAQVSDSDMLTENAVLNAHSVKPCST
SKTHFL.
back to top

mRNA from alignment at Scc4a34_3:15685..16799-

Legend: CDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>MSAD_210003.t1 ID=MSAD_210003.t1|Name=MSAD_210003.t1|organism=Medicago sativa|type=mRNA|length=1115bp|location=Sequence derived from alignment at Scc4a34_3:15685..16799- (Medicago sativa)
ATGATTGAAAATGTTGAAGCATTGTCGTCGCAAGTTGAGAATTTGAAAAC TCGGATTGATAGCGTGAAATATGAAAATCCTGGAAAGTTCTGTTCTGCAA CTCAATCGAACATAATTGGGCCGTCTAATGGATTTAATCGTTCTGTTCAT AATTATGGCTCTTTTGCTGGTAAAGAAATTCCAGTTCCAGGTAGTTTTGC CGGTAAATCTGAGTTATATGCGGAAGATCAACTTATGACTGACGATGTAT TATCAACTCGAGAAGGGATAACTCCTTCCATCGAATCTGCCAATAGGTCC CAGTTTGAGGTTCAGGGAGAAAATGTAAGCTTCATTATTTGAAAGTTATT TCAGCAATTTGTATGTCATTTGTGTTTTCCATTTTGATTGCATAAGTTTC CACTGCCTGCACCATGCTATTGGTTTTGTTTAGTTTTTATTGCACAATCT ATCCATCATCCATGAAGAAAGTTGTTCACAATTCACAAGATTTTAGATTC CACAAAGCTTTTATAATCCAGTTTTTGTTAATACTCATTTCTTGTTATCC CAAATAAATGTCCTTGGTATCTTGGTGAATGATTTTAAATTTTTCTTATG CACGTGTATAGTAAAATACTCTTGACCTGTCATGTATATAGTAAAATACT CTCGACCTGTCATAACCCGGCCATGTTATCTGTATTCTTTGTTGTGTACT TTTAAGTGTTGCCAACCGCGTATCACAGAAAATTGTAGTTTGTTTCAAAT TCTCCTACACCACAATGTTATAGCCCCGCTATAGCCTTTATTTGACAACA CCACTGGTACCTTTACTTTTAATGTTTGGAGTTGATAACAATAATATATT AGTCATGTACCCATTTGTCGTATAATGGAAAACTTTGTCCAATTGCTCCG CGTAATAGGATTATTGCAGACATCATAAATTTGTAACGTTGTCATTTTCT TGTAATGTTATGATTCAGCTGGAAGAGAAATCCAATGAATCAGTTGAAGA GCAGAAATGCATTTCTTCAGCTCAAGTTTCAGACTCTGACATGCTCACTG AGAATGCTGTTCTTAATGCTCATTCTGTTAAACCATGTTCAACATCCAAG ACTCATTTTCTCTAG
back to top

Coding sequence (CDS) from alignment at Scc4a34_3:15685..16799-

>MSAD_210003.t1 ID=MSAD_210003.t1|Name=MSAD_210003.t1|organism=Medicago sativa|type=CDS|length=471bp|location=Sequence derived from alignment at Scc4a34_3:15685..16799- (Medicago sativa)
ATGATTGAAAATGTTGAAGCATTGTCGTCGCAAGTTGAGAATTTGAAAAC
TCGGATTGATAGCGTGAAATATGAAAATCCTGGAAAGTTCTGTTCTGCAA
CTCAATCGAACATAATTGGGCCGTCTAATGGATTTAATCGTTCTGTTCAT
AATTATGGCTCTTTTGCTGGTAAAGAAATTCCAGTTCCAGGTAGTTTTGC
CGGTAAATCTGAGTTATATGCGGAAGATCAACTTATGACTGACGATGTAT
TATCAACTCGAGAAGGGATAACTCCTTCCATCGAATCTGCCAATAGGTCC
CAGTTTGAGGTTCAGGGAGAAAATCTGGAAGAGAAATCCAATGAATCAGT
TGAAGAGCAGAAATGCATTTCTTCAGCTCAAGTTTCAGACTCTGACATGC
TCACTGAGAATGCTGTTCTTAATGCTCATTCTGTTAAACCATGTTCAACA
TCCAAGACTCATTTTCTCTAG
back to top
Properties
Property NameValue
NoteUncharacterized protein MAKER:14.8:0.5:Medtr7g007590
AED0.50
QI0|1|0|1|1|1|2|0|156
eAED0.50
CADL Non-redundant FlagY
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly and Annotation of Medicago sativa2016-01-05
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Scc4a34_3supercontigScc4a34_3:15685..16799 -