MSAD_210001.t1 (mRNA; Medicago sativa )

Overview
NameMSAD_210001.t1
Unique NameMSAD_210001.t1
TypemRNA
OrganismMedicago sativa (alfalfa)
Sequence length792
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
MSAD_210001MSAD_210001Medicago sativagene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210001.t1MSAD_210001.t1-proteinMedicago sativapolypeptide


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210001.t1:exon:0MSAD_210001.t1:exon:0Medicago sativaexon
MSAD_210001.t1:exon:1MSAD_210001.t1:exon:1Medicago sativaexon
MSAD_210001.t1:exon:2MSAD_210001.t1:exon:2Medicago sativaexon
MSAD_210001.t1:exon:3MSAD_210001.t1:exon:3Medicago sativaexon
MSAD_210001.t1:exon:4MSAD_210001.t1:exon:4Medicago sativaexon
MSAD_210001.t1:exon:5MSAD_210001.t1:exon:5Medicago sativaexon
MSAD_210001.t1:exon:6MSAD_210001.t1:exon:6Medicago sativaexon
MSAD_210001.t1:exon:7MSAD_210001.t1:exon:7Medicago sativaexon
MSAD_210001.t1:exon:8MSAD_210001.t1:exon:8Medicago sativaexon


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210001.t1:cdsMSAD_210001.t1:cdsMedicago sativaCDS


Synonyms
The feature 'MSAD_210001.t1' has the following synonyms
Synonym
maker-Scc4a34_2-snap-gene-0.5-mRNA-1
Sequences
The following sequences are available for this feature:

mRNA sequence

>MSAD_210001.t1 ID=MSAD_210001.t1|Name=MSAD_210001.t1|organism=Medicago sativa|type=mRNA|length=792bp
atgaggggagccaaaaccgcttcatctttcccttcccctgttttcaaaac
cgctccatcttcttcttcttccctgttttctctttctggtggctgctccg
atcttcttcctcacagaacagtgaaacctaaagacattttattcatggca
gacaaggcacatttagtgcgggcggctgaattgctgcagcaattgcgcat
ggtgctgcagtgcagaaattatcccaagaaagtgaggttcatggtaccac
attttttgccatattcacctcaaaagaatgttgccaagggtccatctttt
cacggaaaagcaatagatgctgtgaagctcctcaaatatgtcaaaaaatt
tcagaggctgctaggattgaagtactgtatttcttttactgaagctgtgt
ttgcagcatgtgatgctgctcatgtaagatgggcaaagcttctgggggtc
cgtgctactctccatcctaggttgaaactgcaggagtttctaactgttta
caacatcacccatgagttcattacagctacagaaaaaattggtggaagat
tgggatacagcatccgtgggatactgcattcacaggccaaggcttttatt
gattgtcagcatgattctcgggtgtcaaaaattatggcagtgcttgacca
ggaaacatgggtggagatagatgttcctgatgattttcaatccattatca
atacgctttttccattggatgcattgtcttctggggaccctaatggtgtt
gaagaagataattcaaacagttaccatgatttggcgaactaa
back to top

protein sequence of MSAD_210001.t1

>MSAD_210001.t1-protein ID=MSAD_210001.t1-protein|Name=MSAD_210001.t1|organism=Medicago sativa|type=polypeptide|length=264bp
MRGAKTASSFPSPVFKTAPSSSSSLFSLSGGCSDLLPHRTVKPKDILFMA
DKAHLVRAAELLQQLRMVLQCRNYPKKVRFMVPHFLPYSPQKNVAKGPSF
HGKAIDAVKLLKYVKKFQRLLGLKYCISFTEAVFAACDAAHVRWAKLLGV
RATLHPRLKLQEFLTVYNITHEFITATEKIGGRLGYSIRGILHSQAKAFI
DCQHDSRVSKIMAVLDQETWVEIDVPDDFQSIINTLFPLDALSSGDPNGV
EEDNSNSYHDLAN.
back to top

mRNA from alignment at Scc4a34_2:1471..5633+

Legend: exonCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>MSAD_210001.t1 ID=MSAD_210001.t1|Name=MSAD_210001.t1|organism=Medicago sativa|type=mRNA|length=4163bp|location=Sequence derived from alignment at Scc4a34_2:1471..5633+ (Medicago sativa)
atgagggggtatacagagtcggttcgcttgagttcgtattatacatgttg atatattatactatcaacaaattttggtcaaatttaaaaataaaaataca aattttggtctaattaaaatataaaattaaatagttatatcaaaatatga aggaaaaaaaataacattagaaattagatttggagagttgtgtatctaat aaggtcacgtggggatagtttgctttaccaatacccaattttttaattgt ttttttcatagaaaaaagaaaaagaagaaaagcctgacaccgttttgttt tctctttccatgttcccagagccaaaaccgcttcatctttcccttcccct gttttcaaaaccgctccatcttcttcttcttccctgttttctctttctgg tggctgctccgatcttcttcctcacaggttcgtcactttcaacgtactag aaaacgaattcgcggccgtaacggcgtttcgcgcccgtaacggcgttccg taacggccgtaacggcgatttggctgtgatttttgttctcaacgcgaaaa ggtccaaaaacggtcacggtggctgccgataccgatttgtaacggccgca atcccggtaacattccgttttttgaaaccttgggtattgtatcaatgtat ctattgtgtatagatgtcctaaaataccatttgttttttttcaactgtga cacctcatctccaaaacatttagtagtattaattgtgtgtatttgaaaaa ataataaatgtatctagtaatttttaaatggggattatatttatggacac tttttttttttgtctggaaaaaggagcttatattgagaacaaagtagtaa tgtttatagaacattctctttccattgatacatgaaatacagtttatttt caattactattggtattcatagcaagttctaagccctattctttggtcct agggtaactagtttttagttcggtgatcccaaagagaaaccttctataga tatcattttgaaataaatatttctcattaactatgaaaagggctgaacaa atatttttatacacgtgagatggaatctaaataggaatattatcctatca ttaatcctactactagcaaatcttgatataatcaatcttaatatctttca acacatatgaatgtatatgcttcaccttaaggggcatgtcgggattatgt aacattatattcagataatatcctgattgttgtttctggtattatttccc aagtgtcctttttagttattttttattccttaaccagtagggattgatca ggttaacttcttgtatacatgttgtacattctcctttccttgatacaaga aaatacaatatattttcaatctgaagtccgatcattatgctctatgctat ctttgaagtgatcgtgatcttcatgtaactccttgagtgtttagttttgt ttctttatatatgtgagaatctgaaatctgagttatatcaaatcttgaat agagagaaaagagagacatatgatgaaaactgtgcgtctgaatagcacta cggaagattatttatacaggagtttagtaacttagagactaagctaggat atatttacagaaggaatattctaaataatattctatgctagtaacttaga gagtaaggtaaatatatttacaatgtaaatataattatcttactatttat ttaaatatcaacatcaacaaatatcacatgtacatgaatcaaaatgctcc ctggtttagaaaattctgtcttgacaatcttgtggtgtttccttaacttt tataatacttagaacagtgaaacctaaagacattttattcatggcagaca aggtttgcatccacgaattctgcaatcacaggacttgaacttttccatat gttagattggttttaatagcattagaatatattgtatgctgtatagtttt tactgcataattttgtctcttggtacattaaaccttcattatcaatggct attgcccaagaaagggattattgactattatgccaacttgtaatgttaaa aacttacatgtttttatcttcctagggagactctatgttattggctatat ttcatgtacaagaatagtgattatgtgtctagggttacagccatgtttac tgaaatttacctttccaatggtttgcactttatcagcttttgtaagagtt gatgtaataagattttttttctttttagtgattgcaggcacatttagtgc gggcggctgaagtgaaaaaagccattgaatggatttgagcaactgttgat ggtcattatgcttctgattcagttgctgcagcaattgcgcatggtgctgc agtgcagaaattatcccaagaaagtgaggttcatggtaccacattttttg ccatattcacctcaaaagaatgttgccaagggtccatcttttcacggaaa agcaatagatgctgtgaagctcctcaaatatgtcaaaaaatttcaggtta aatataggctctttgttctaatacagttgtaatggaaagttttctggatt cttttgtgtttagattggaagaagcatgtaatttatgatgtaggagctaa ttttcctctcacagaaacacctaaactcactaatggagtatagaaatgaa aatactagttttaagttaatagaaatgataaataatttgtattgaaatga aatacttgttgttttgtgcaaaatattttttcatttctcttataagtttg aactgttgatactttattgaatggtgacaaatgtaatatattgaacgaag gactattcctttatagaatccttattcgtaggaactctttttaaacacca gaacactatttatatgtcaaaagccagttaactcgaaagttcaatctgat aggtgaagaaggtacacaaagttttacactaaaagcattatggatctgtc ccatcattttaaaaaccaggctacaaaaaacgaaattggacagaattgtg agaggaaaattaaaagaaaaatgagctagaatattgttaagtgccactac tttctgttcccttaagacttgagtggtttgcacacatgacttcaagctgt agtaaaaccatctatattctatagcatgcatgtctaatatatctggacat tttctttgttgccggcattatctttgcaaacatactatcatccatcccct taataatgttgaatccgtatggtgatactcctctcaaatgtttttatctt atcttgtttagtccttcagatagtaatttttctgttttagaggctgctag gattgaagtactgtatttcttttactggttactaataactaattgctctt atgtaatcttctctcttaaaaaatatgataatgggggttaagaccatgat atggagtccactagatgcttgtaaagtttagtacatggattatataatta taaaataaattatactttgatctagtatgctttctgccattacttttgtg tttttaattgctgcccaatttatttcatgttctcaaaaaatctggtccta aacagagctgagtattgcgagaaaacgcagaagctgtgtttgcagcatgt gatgctgctcatgtaagatgggcaaagcttctgggggtccgtgctactct ccatcctaggttgaaactgcaggagtttctaactgtttacaacatcaccc atgagttcattacagctacagaaaaagtacatattttcattttggtttaa agtttaaatttcaaattatgtggttttagttccctgatttgaactcccaa attaaaactaacagattggtggaagattgggatacagcatccgtgggata ctgcattcacaggccaaggcttttattgattgtcagcatgattctcgggt cagtttaaaatttggtgctttccgttgtgttttatatattatttcctcaa aaactgttcatctctatttaatatcccttgctttgcatttaggtgtcaaa aattatggcagtgcttgaccaggaaacatgggtggagatagatgttcctg atgattttcaatccattatcaatacgctttttccattggatgcattgtct tctggggaccctaatggtgttgaagaagataattcaaacagttaccatga tttggcgaactaa
back to top

Coding sequence (CDS) from alignment at Scc4a34_2:1471..5633+

>MSAD_210001.t1 ID=MSAD_210001.t1|Name=MSAD_210001.t1|organism=Medicago sativa|type=CDS|length=792bp|location=Sequence derived from alignment at Scc4a34_2:1471..5633+ (Medicago sativa)
atgaggggagccaaaaccgcttcatctttcccttcccctgttttcaaaac
cgctccatcttcttcttcttccctgttttctctttctggtggctgctccg
atcttcttcctcacagaacagtgaaacctaaagacattttattcatggca
gacaaggcacatttagtgcgggcggctgaattgctgcagcaattgcgcat
ggtgctgcagtgcagaaattatcccaagaaagtgaggttcatggtaccac
attttttgccatattcacctcaaaagaatgttgccaagggtccatctttt
cacggaaaagcaatagatgctgtgaagctcctcaaatatgtcaaaaaatt
tcagaggctgctaggattgaagtactgtatttcttttactgaagctgtgt
ttgcagcatgtgatgctgctcatgtaagatgggcaaagcttctgggggtc
cgtgctactctccatcctaggttgaaactgcaggagtttctaactgttta
caacatcacccatgagttcattacagctacagaaaaaattggtggaagat
tgggatacagcatccgtgggatactgcattcacaggccaaggcttttatt
gattgtcagcatgattctcgggtgtcaaaaattatggcagtgcttgacca
ggaaacatgggtggagatagatgttcctgatgattttcaatccattatca
atacgctttttccattggatgcattgtcttctggggaccctaatggtgtt
gaagaagataattcaaacagttaccatgatttggcgaactaa
back to top
Properties
Property NameValue
NoteVacuolar sorting protein MAKER:11.2:0.27:Medtr2g047908
AED0.27
QI0|0.25|0.11|0.33|0.75|0.88|9|0|263
eAED0.27
CADL Non-redundant FlagY
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly and Annotation of Medicago sativa2016-01-05
Gene Ontology Update2017-11-12
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Scc4a34_2supercontigScc4a34_2:1471..5633 +
Gene Ontology
GO Assignments
This mRNA is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0042147 retrograde transport, endosome to Golgi
cellular_component GO:0005829 cytosol