MSAD_210000.t1 (mRNA; Medicago sativa )

Overview
NameMSAD_210000.t1
Unique NameMSAD_210000.t1
TypemRNA
OrganismMedicago sativa (alfalfa)
Sequence length2313
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
MSAD_210000MSAD_210000Medicago sativagene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210000.t1MSAD_210000.t1-proteinMedicago sativapolypeptide


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210000.t1:cdsMSAD_210000.t1:cdsMedicago sativaCDS


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210000.t1:exon:0MSAD_210000.t1:exon:0Medicago sativaexon
MSAD_210000.t1:exon:1MSAD_210000.t1:exon:1Medicago sativaexon
MSAD_210000.t1:exon:2MSAD_210000.t1:exon:2Medicago sativaexon
MSAD_210000.t1:exon:3MSAD_210000.t1:exon:3Medicago sativaexon
MSAD_210000.t1:exon:4MSAD_210000.t1:exon:4Medicago sativaexon
MSAD_210000.t1:exon:5MSAD_210000.t1:exon:5Medicago sativaexon
MSAD_210000.t1:exon:6MSAD_210000.t1:exon:6Medicago sativaexon
MSAD_210000.t1:exon:7MSAD_210000.t1:exon:7Medicago sativaexon
MSAD_210000.t1:exon:8MSAD_210000.t1:exon:8Medicago sativaexon
MSAD_210000.t1:exon:9MSAD_210000.t1:exon:9Medicago sativaexon
MSAD_210000.t1:exon:10MSAD_210000.t1:exon:10Medicago sativaexon
MSAD_210000.t1:exon:11MSAD_210000.t1:exon:11Medicago sativaexon
MSAD_210000.t1:exon:12MSAD_210000.t1:exon:12Medicago sativaexon
MSAD_210000.t1:exon:13MSAD_210000.t1:exon:13Medicago sativaexon
MSAD_210000.t1:exon:14MSAD_210000.t1:exon:14Medicago sativaexon
MSAD_210000.t1:exon:15MSAD_210000.t1:exon:15Medicago sativaexon
MSAD_210000.t1:exon:16MSAD_210000.t1:exon:16Medicago sativaexon
MSAD_210000.t1:exon:17MSAD_210000.t1:exon:17Medicago sativaexon


Synonyms
The feature 'MSAD_210000.t1' has the following synonyms
Synonym
maker-Scc4a34_1-snap-gene-0.0-mRNA-1
Sequences
The following sequences are available for this feature:

mRNA sequence

>MSAD_210000.t1 ID=MSAD_210000.t1|Name=MSAD_210000.t1|organism=Medicago sativa|type=mRNA|length=2313bp
atgcaaaaatatcccatggaagtcgtagttatgttgtttacctatccaac
gaattgtcacatgctaagattcaatgcaaatcggccacattatggccttc
ctagtaaaaaagggtcgaaaacgagtaatagaatgcaaaaatatcccatg
gaagtcgtagttatgttgtttacctatccaacgaattgtcacatgctaag
attcaatgcaaatcggccacattatggccttcctagtaaaaaagggtcga
aaacgagtaatagaatgcaaaaatatcccatggaagtcgtagttatgttg
tttacctatccaacgaattgtcacatgctaagattcaatgcaaatcggcc
acattatggccttcctagtaaaaaagggtcgaaaacgagtaatagaatgc
aaaaatatcccatggaagtcgtagttatgttgtttacctatccaacgaat
tgtcacatgctaagattcaatgcaaatcggccacattatggccttcctag
taaaaaagggtcgaaaacgagtaatagaatgcaaaaatatcccatggaag
tcgtagttatgttgtttacctatccaacgaattgtcacatgctaagattc
aatgcaaatcggccacattatggccttcctagtaaaaaagggtcgaaaac
gagtaatagaatgcaaaaatatcccatggaagtcgtagttatgttgttta
cctatccaacgaattgtcacatgctaagattcaatgcaaatcggccacat
tatggccttcctagtaaaaaagggtcgaaaacgagtaatagaatgcaaaa
atatcccatggaagtcgtagttatgttgtttacctatccaacgaattgtc
acatgctaagattcaatgcaaatcggccacattatggccttcctagtaaa
aaagggtcgaaaacgagtaatagaatgcaaaaatatcccatggaagtcgt
agttatgttgtttacctatccaacgaattgtcacatgctaagattcaatg
caaatcggccacattatggccttcctagtaaaaaagggtcgaaaacgagt
aatagaatgcaaaaatatcccatggaagtcgtagttatgttgtttaccta
tccaacgaattgtcacatgctaagattcaatgcaaatcggccacattatg
gccttcctagtaaaaaagggtcgaaaacgagtaatagaatgcaaaaatat
cccatggaagtcgtagttatgttgtttacctatccaacgaattgtcacat
gctaagattcaatgcaaatcggccacattatggccttcctagtaaaaaag
ggtcgaaaacgagtaatagaatgcaaaaatatcccatggaagtcgtagtt
atgttgtttacctatccaacgaattgtcacatgctaagattcaatgcaaa
tcggccacattatggccttcctagtaaaaaagggtcgaaaacgagtaata
gaatgcaaaaatatcccatggaagtcgtagttatgttgtttacctatcca
acgaattgtcacatgctaagattcaatgcaaatcggccacattatggcct
tcctagtaaaaaagggtcgaaaacgagtaatagaatgcaaaaatatccca
tggaagtcgtagttatgttgtttacctatccaacgaattgtcacatgcta
agattcaatgcaaatcggccacattatggccttcctagtaaaaaagggtc
gaaaacgagtaatagaatgcaaaaatatcccatggaagtcgtagttatgt
tgtttacctatccaacgaattgtcacatgctaagattcaatgcaaatcgg
ccacattatggccttcctagtaaaaaagggtcgaaaacgagtaatagaat
gcaaaaatatcccatggaagtcgtagttatgttgtttacctatccaacga
attgtcacatgctaagattcaatgcaaatcggccacattatggccttcct
agtaaaaaagggtcgaaaacgattatgttgtttacctatccaacgaattg
tcacatgctaagattcaatgcaaatcggccacattatggccttcctagta
aaaaagggtcgaaaacgagtaatagaatgcaaaaatatcccatggaagtc
gtagttatgttgtttacctatccaacgaattgtcacatgctaagattcaa
tgcaaatcggccacattatggccttcctagtaaaaaagggtcgaaaacga
ttatgttgtttacctatccaacgaattgtcacatgctaagattcaatgca
aatcggccacattatggccttcctagtaaaaaagggtcgaaaacgagtaa
tgtcctaaattaa
back to top

protein sequence of MSAD_210000.t1

>MSAD_210000.t1-protein ID=MSAD_210000.t1-protein|Name=MSAD_210000.t1|organism=Medicago sativa|type=polypeptide|length=771bp
MQKYPMEVVVMLFTYPTNCHMLRFNANRPHYGLPSKKGSKTSNRMQKYPM
EVVVMLFTYPTNCHMLRFNANRPHYGLPSKKGSKTSNRMQKYPMEVVVML
FTYPTNCHMLRFNANRPHYGLPSKKGSKTSNRMQKYPMEVVVMLFTYPTN
CHMLRFNANRPHYGLPSKKGSKTSNRMQKYPMEVVVMLFTYPTNCHMLRF
NANRPHYGLPSKKGSKTSNRMQKYPMEVVVMLFTYPTNCHMLRFNANRPH
YGLPSKKGSKTSNRMQKYPMEVVVMLFTYPTNCHMLRFNANRPHYGLPSK
KGSKTSNRMQKYPMEVVVMLFTYPTNCHMLRFNANRPHYGLPSKKGSKTS
NRMQKYPMEVVVMLFTYPTNCHMLRFNANRPHYGLPSKKGSKTSNRMQKY
PMEVVVMLFTYPTNCHMLRFNANRPHYGLPSKKGSKTSNRMQKYPMEVVV
MLFTYPTNCHMLRFNANRPHYGLPSKKGSKTSNRMQKYPMEVVVMLFTYP
TNCHMLRFNANRPHYGLPSKKGSKTSNRMQKYPMEVVVMLFTYPTNCHML
RFNANRPHYGLPSKKGSKTSNRMQKYPMEVVVMLFTYPTNCHMLRFNANR
PHYGLPSKKGSKTSNRMQKYPMEVVVMLFTYPTNCHMLRFNANRPHYGLP
SKKGSKTIMLFTYPTNCHMLRFNANRPHYGLPSKKGSKTSNRMQKYPMEV
VVMLFTYPTNCHMLRFNANRPHYGLPSKKGSKTIMLFTYPTNCHMLRFNA
NRPHYGLPSKKGSKTSNVLN.
back to top

mRNA from alignment at Scc4a34_1:266..4826-

Legend: CDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>MSAD_210000.t1 ID=MSAD_210000.t1|Name=MSAD_210000.t1|organism=Medicago sativa|type=mRNA|length=4561bp|location=Sequence derived from alignment at Scc4a34_1:266..4826- (Medicago sativa)
ATGCAAAAATATCCCATGGAAGTCGTAGTTATGTTGTTTACCTATCCAAC GAATTGTCACATGCTAAGATTCAATGCAAATCGGCCACATTATGGCCTTC CTAGTAAAAAAGGGTCGAAAACGAGTAATGTCCTAAATTAACGAGGAGAT TTTCTTAACCTCCATTTTGGCCGAATTTTTAGAGAATGCAAAAATATCCC ATGGAAGTCGTAGTTATGTTGTTTACCTATCCAACGAATTGTCACATGCT AAGATTCAATGCAAATCGGCCACATTATGGCCTTCCTAGTAAAAAAGGGT CGAAAACGAGTAATGTCCTAAATTAACGAGGAGATTTTCTTAACCTCCAT TTTGGCCGAATTTTTAGAGAATGCAAAAATATCCATGGAAGTCGTAGTTA TGTTGTTTACCTATCCAACGAATTGTCACATGCTAAGATTCAATGCAAAT CGGCCCATTATGGCCTTCCTAGTAAAAAAGGGTCGAAAACGAGTAATGTC CTAAATTAACGAGGAGATTTTCTTAACCTCCATTTTGGCCGAATTTTTAG AGAATGCAAAAATATCCCATGGAAGTCGTAGTTATGTTGTTTACCTATCC AACGAATTGTCACATGCTAAGATTCAATGCAAATCGGCCACATTATGGCC TTCCTAGTAAAAAAGGGTCGAAAACGAGTAATGTCCTAAATTAACGAGGA GATTTTCTTAACCTCCATTTTGGCCGAATTTTTAGAGAATGCAAAAATAT CCCATGGAAGTCGTAGTTATGTTGTTTACCTATCCAACGAATTGTCACAT GCTAAGATTCAATGCAAATCGGCCACATTATGGCCTTCCTAGTAAAAAAG GGTCGAAAACGAGTAATGTCCTAAATTAACGAGGAGATTTTCTTAACCTC CATTTTGGCCGAATTTTTAGAGAATGCAAAAATATCCCATGGAAGTCGTA GTTATGTTGTTTACCTATCCAACGAATTGTCACATGCTAAGATTCAATGC AAATCGGCCACATTATGGCCTTCCTAGTAAAAAAGGGTCGAAAACGAGTA ATGTCCTAAATTAACGAGGAGATTTTCTTAACCTCCATTTTGGCCGAATT TTTAGAGAATGCAAAAATATCCCATGGAAGTCGTAGTTATGTTGTTTACC TATCCAACGAATTGTCACATGCTAAGATTCAATGCAAATCGGCCACATTA TGGCCTTCCTAGTAAAAAAGGGTCGAAAACGAGTAATGTCCTAAATTAAC GAGGAGATTTTCTTAACCTCCATTTTGGCCGAATTTTTAGAGAATGCAAA AATATCCCATGGAAGTCGTAGTTATGTTGTTTACCTATCCAACGAATTGT CACATGCTAAGATTCAATGCAAATCGGCCACATTATGGCCTTCCTAGTAA AAAAGGGTCGAAAACGAGTAATGTCCTAAATTAACGAGGAGATTTTCTTA ACCTCCATTTTGGCCGAATTTTTAGAGAATGCAAAAATATCCCATGGAAG TCGTAGTTATGTTGTTTACCTATCCAACGAATTGTCACATGCTAAGATTC AATGCACACATTATGGCCTTCCTAGTAAAAAAGGGTCGAAAACGAGTAAT GTCCTAAATTAACGAGGAGATTTTCTTAACCTCCATTTTGGCCGAATTTT TAGAGAATGCAAAAATATCCCATGGAAGTCGTAGTTATGTTGTTTACCTA TCCAACGAATTGTCACATGCTAAGATTCAATGCAAATCGGCCACATTATG GCCTTCCTAGTAAAAAAGGGTCGAAAACGAGTAATGTCCTAAATTAACGA GGAGATTTTCTTAACCTCCATTTTGGCCGAATTTTTAGAGAATGCAAAAA TATCCCATGGAAGTCGTAGTTATGTTGTTTACCTATCCAACGAATTGTCA CATGCTAAGATTCAATGCAAATCGGCCACATTATGGCCTTCCTAGTAAAA AAGGGTCGAAAACGAGTAATGTCCTAAATTAACGAGGAGATTTTCTTAAC CTCCATTTTGGCCGAATTTTTAGAGAATGCAAAAATATCCCATGGAAGTC GTAGTTATGTTGTTTACCTATCCAACGAATTGTCACATGCTAAGATTCAA TAAATCGGCCACATTATGGCCTTCCTAGTAAAAAAGGGTCGAAAACGAGT AATGTCCTAAATTAACGAGGAGATTTTCTTAACCTCCATTTTGGCCGAAT TTTTAGAGAATGCAAAAATATCCCATGGAAGTCGTAGTTATGTTGTTTAC CTATCCAACGAATTGTCACATGCTAAGATTCAATGCAAATCGGCCACATT ATGGCCTTCCTAGTAAAAAAGGGTCGAAAACGAGTAATGTCCTAAATTAA CGAGGAGATTTTCTTAACCTCCATTTTGGCCGAATTTTTAGAGAATGCAA AAATATCCCATGGAAGTCGTAGTTATGTTGTTTACCTATCCAACGAATTG TCACATGCTAAGATTCAATGCAAATCGGCCACTTATGGCCTTCCTAGTAA AAAAGGGTCGAAAACGAGTAATGTCCTAAATTAACGAGGAGATTTTCTTA ACCTCCATTTTGGCCGAATTTTTAGAGAATGCAAAAATATCCCATGGAAG TCGTAGTTATGTTGTTTACCTATCCAACGAATTGTCACATGCTAAGATTC AATGCAAATCGGCCACATTATGGCCTTCCTAGTAAAAAAGGGTCGAAAAC GAGTAATGTCCTAAATTAACGAGGAGATTTTCTTAACCTCCATTTTGGCC GAATTTTTAGAGAATGCAAAAATATCCCATGGAAGTCGTAGTTATGTTGT TTACCTATCCAACGAATTGTCACATGCTAAGATTCAATGCAAATCGGCCA CATTATGGCCTTCCTAGTAAAAAAGGGTCGAAAACGAGTAATGTCCTAAA TTAACGAGGAGATTTTCTTAACCTCCATTTTGGCCGAATTTTTAGAGAAT GCAAAAATATCCATGGAAGTCGTAGTTATGTTGTTTACCTATCCAACGAA TTGTCACATGCTAAGATTCAATGCAAATCGGCCACATTATGGCCTTCCTA GTAAAAAAGGGTCGAAAACGAGTAATGTCCTAAATTAACGAGGAGATTTT CTTAACCTCCATTTTGGCCGAATTTTTAGAGAATGCAAAAATATCCCATG GAAGTCGTAGTTATGTTGTTTACCTATCCAACGAATTGTCACATGCTAAG ATTCAATGCAAATCGGCCACATTGGCCTTCCTAGTAAAAAAGGGTCGAAA ACGAGTAATGTCCTAAATTAACGAGGAGATTTTCTTAACCTCCATTTTGG CCGAATTTTTAGAGAATGCAAAAATATCCCATGGAAGTCGTAGTTATGTT GTTTACCTATCCAACGAATTGTCACATGCTAAGATTCAATGCAAATCGGC CACATTATGGCCTTCCTAGTAAAAAAGGGTCGAAAACGAGTAATGTCCTA AATTAACGAGGAGATTTTCTTAACCTCCATTTTGGCCGAATTTTTAGAGA ATGCAAAAATATCCCATGGAAGTCGTAGTTATGTTGTTTACCTATCCAAC GAATTGTCACATGCTAAGATTCAATGCAAATCGGCCACATTATGGCCTTC CTAGTAAAAAAGGGTCGAAAACGAGTAATGTCCTAAATTAACGAGGAGAT TTTCTTAACCTCCATTTTGGCCGAATTTTTAGAGAATGCAAAAATATCCC ATGGAAGTCGTAGTTATGTTGTTTACCTATCCAACGAATTGTCACATGCT AAGATTCAATGCAAATCGGCCACATTATGGCCTTCCTAGTAAAAAAGGGT CGAAAACGAGTAATGTCCTAAATTAACGAGGAGATTTTCTTAACCTCCAT TTTGGCCGAATTTTTAGAGAATGCAAAAATATCCATGGAAGTCGTAGTTA TGTTGTTTACCTATCCAACGAATTGTCACATGCTAAGATTCAATGCAAAT CGGCCACATTATGGCCTTCCTAGTAAAAAAGGGTCGAAAACGAGTAATGT CCTAAATTAACGAGGAGATTTTCTTAACCTCCATTTTGGCCGAATTTTTA GAGAATGCAAAAATATCCCATGGAAGTCGTAGTTATGTTGTTTACCTATC CAACGAATTGTCACATGCTAAGATTCAATGCAAATCACATTATGGCCTTC CTAGTAAAAAAGGGTCGAAAACGAGTAATGTCCTAAATTAACGAGGAGAT TTTCTTAACCTCCATTTTGGCCGAATTTTTAGAGAATGCAAAAATATCCC ATGGAAGTCGTAGTTATGTTGTTTACCTATCCAACGAATTGTCACATGCT AAGATTCAATGCAAATCGGCCACATTATGGCCTTCCTAGTAAAAAAGGGT CGAAAACGAGTAATGTCCTAAATTAACGAGGAGATTTTCTTAACCTCCAT TTTGGCCGAATTTTTAGAGAATGCAAAAATATCCCATGGAAGTCGTAGTT ATGTTGTTTACCTATCCAACGAATTGTCACATGCTAAGATTCAATGCAAA TCGGCCACATTATGGCCTTCCTAGTAAAAAAGGGTCGAAAACGAGTAATG TCCTAAATTAA
back to top

Coding sequence (CDS) from alignment at Scc4a34_1:266..4826-

>MSAD_210000.t1 ID=MSAD_210000.t1|Name=MSAD_210000.t1|organism=Medicago sativa|type=CDS|length=2313bp|location=Sequence derived from alignment at Scc4a34_1:266..4826- (Medicago sativa)
ATGCAAAAATATCCCATGGAAGTCGTAGTTATGTTGTTTACCTATCCAAC
GAATTGTCACATGCTAAGATTCAATGCAAATCGGCCACATTATGGCCTTC
CTAGTAAAAAAGGGTCGAAAACGAGTAATAGAATGCAAAAATATCCCATG
GAAGTCGTAGTTATGTTGTTTACCTATCCAACGAATTGTCACATGCTAAG
ATTCAATGCAAATCGGCCACATTATGGCCTTCCTAGTAAAAAAGGGTCGA
AAACGAGTAATAGAATGCAAAAATATCCCATGGAAGTCGTAGTTATGTTG
TTTACCTATCCAACGAATTGTCACATGCTAAGATTCAATGCAAATCGGCC
ACATTATGGCCTTCCTAGTAAAAAAGGGTCGAAAACGAGTAATAGAATGC
AAAAATATCCCATGGAAGTCGTAGTTATGTTGTTTACCTATCCAACGAAT
TGTCACATGCTAAGATTCAATGCAAATCGGCCACATTATGGCCTTCCTAG
TAAAAAAGGGTCGAAAACGAGTAATAGAATGCAAAAATATCCCATGGAAG
TCGTAGTTATGTTGTTTACCTATCCAACGAATTGTCACATGCTAAGATTC
AATGCAAATCGGCCACATTATGGCCTTCCTAGTAAAAAAGGGTCGAAAAC
GAGTAATAGAATGCAAAAATATCCCATGGAAGTCGTAGTTATGTTGTTTA
CCTATCCAACGAATTGTCACATGCTAAGATTCAATGCAAATCGGCCACAT
TATGGCCTTCCTAGTAAAAAAGGGTCGAAAACGAGTAATAGAATGCAAAA
ATATCCCATGGAAGTCGTAGTTATGTTGTTTACCTATCCAACGAATTGTC
ACATGCTAAGATTCAATGCAAATCGGCCACATTATGGCCTTCCTAGTAAA
AAAGGGTCGAAAACGAGTAATAGAATGCAAAAATATCCCATGGAAGTCGT
AGTTATGTTGTTTACCTATCCAACGAATTGTCACATGCTAAGATTCAATG
CAAATCGGCCACATTATGGCCTTCCTAGTAAAAAAGGGTCGAAAACGAGT
AATAGAATGCAAAAATATCCCATGGAAGTCGTAGTTATGTTGTTTACCTA
TCCAACGAATTGTCACATGCTAAGATTCAATGCAAATCGGCCACATTATG
GCCTTCCTAGTAAAAAAGGGTCGAAAACGAGTAATAGAATGCAAAAATAT
CCCATGGAAGTCGTAGTTATGTTGTTTACCTATCCAACGAATTGTCACAT
GCTAAGATTCAATGCAAATCGGCCACATTATGGCCTTCCTAGTAAAAAAG
GGTCGAAAACGAGTAATAGAATGCAAAAATATCCCATGGAAGTCGTAGTT
ATGTTGTTTACCTATCCAACGAATTGTCACATGCTAAGATTCAATGCAAA
TCGGCCACATTATGGCCTTCCTAGTAAAAAAGGGTCGAAAACGAGTAATA
GAATGCAAAAATATCCCATGGAAGTCGTAGTTATGTTGTTTACCTATCCA
ACGAATTGTCACATGCTAAGATTCAATGCAAATCGGCCACATTATGGCCT
TCCTAGTAAAAAAGGGTCGAAAACGAGTAATAGAATGCAAAAATATCCCA
TGGAAGTCGTAGTTATGTTGTTTACCTATCCAACGAATTGTCACATGCTA
AGATTCAATGCAAATCGGCCACATTATGGCCTTCCTAGTAAAAAAGGGTC
GAAAACGAGTAATAGAATGCAAAAATATCCCATGGAAGTCGTAGTTATGT
TGTTTACCTATCCAACGAATTGTCACATGCTAAGATTCAATGCAAATCGG
CCACATTATGGCCTTCCTAGTAAAAAAGGGTCGAAAACGAGTAATAGAAT
GCAAAAATATCCCATGGAAGTCGTAGTTATGTTGTTTACCTATCCAACGA
ATTGTCACATGCTAAGATTCAATGCAAATCGGCCACATTATGGCCTTCCT
AGTAAAAAAGGGTCGAAAACGATTATGTTGTTTACCTATCCAACGAATTG
TCACATGCTAAGATTCAATGCAAATCGGCCACATTATGGCCTTCCTAGTA
AAAAAGGGTCGAAAACGAGTAATAGAATGCAAAAATATCCCATGGAAGTC
GTAGTTATGTTGTTTACCTATCCAACGAATTGTCACATGCTAAGATTCAA
TGCAAATCGGCCACATTATGGCCTTCCTAGTAAAAAAGGGTCGAAAACGA
TTATGTTGTTTACCTATCCAACGAATTGTCACATGCTAAGATTCAATGCA
AATCGGCCACATTATGGCCTTCCTAGTAAAAAAGGGTCGAAAACGAGTAA
TGTCCTAAATTAA
back to top
Properties
Property NameValue
NoteUncharacterized protein MAKER:0.0:0.07:Medtr2g084470
AED0.07
QI0|0|0|1|0|0|18|0|770
eAED0.07
CADL Non-redundant FlagN
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly and Annotation of Medicago sativa2016-01-05
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Scc4a34_1supercontigScc4a34_1:266..4826 -